La présentation est en train de télécharger. S'il vous plaît, attendez

La présentation est en train de télécharger. S'il vous plaît, attendez

BIOTECHNOLOGIE PHARMACEUTIQUE De léprouvette au produit final La totalité du matériel présenté est disponible à ladresse web:

Présentations similaires


Présentation au sujet: "BIOTECHNOLOGIE PHARMACEUTIQUE De léprouvette au produit final La totalité du matériel présenté est disponible à ladresse web:"— Transcription de la présentation:

1 BIOTECHNOLOGIE PHARMACEUTIQUE De léprouvette au produit final La totalité du matériel présenté est disponible à ladresse web: PHA 2501: Sciences Pharmaceutiques II Alain Garnier, Laboratoire doptimisation des bioprocédés (LOB), génie chimique, PROTEO, Hiver 2010

2 Définition et contexte Biotechnologie: lapplication de la science et de la technologie aux organismes vivants, à dautres matériaux vivants ou non vivants, pour la production de savoir, biens et services. (source: OCDE) Traditionnelle: Utilisation de micro-organismes et denzymes sélectionnés pour produire des agents dintérêt; Isolation d'agents à partir de sources biologiques. Contemporaine: Utilisation de micro-organismes et denzymes modifiés, directement ou non, pour produire des agents dintérêt.

3 Les médicaments d'origine biologique Traditionnels: D'origine animale: produits sanguins, hormones, stéroïdes, catécholamines, prostaglandines, anticorps, insuline, vaccins… D'origine végétale: alcaloïdes, flavonoïdes, méthylxanthines, terpénoïdes, glycosides cardiotoniques et coumarines, ac salicylique… D'origine microbienne: antibiotiques, enzymes, protéases, vaccins, … D'origine virale: vaccins

4 Les médicaments d'origine biologique (suite) Biopharmaceutique: substance utilisée à des fins thérapeutiques ou diagnostiques, à base d'acides nucléiques ou de protéines, produites par des moyens autre que l'extraction directe d'une source biologique non-modifiée. Exemples: Facteurs sanguins (facteurs VIII et Factor IX) Agents trombolytiques (activateur tissulaire du plasminogène) Hormones (insuline, hormone de croissance, gonadotrophine, etc) Facteurs de croissance (cytokines, interférons (IFN), interleukines (IL), érythropoïétine (EPO), facteur de croissance des colonies, …) Vaccins (méningocoque, influenza, antigène de surface de l'hépatite B, …) Anticorps monoclonaux Autres (facteur de nécrose tumorale, plasmides, vecteurs viraux, microARN, ARNi, …)

5 Seulement 12% des nouveaux médicaments sont produits par synthèse/extraction % de médicaments approuvés ou en essais cliniques en 2000 (Odum, Pharma. Eng., 2001)

6 Plan Cibles Sources Produits/caractérisques Méthodes analytiques Développement de systèmes de production Construction/sélection Procédés de production Procédés de séparation

7 Cibles des biopharmaceutiques Francis Crick, 1958 (source: NCBI) traduction PROTÉINE ARN ADN Dépistage/ thérapie génique Transcriptome/ ARNi Protéome/ Anticorps, hormones… DIAGNOSTIC/THÉRAPIE Syst immunitaire/vaccin Métabolisme/ Thérapie cellulaire

8 Sources de biopharmaceutiques Virus Bactéries Levures Moisissures Cellules animales Invertébrés Mammifères Primates non-humains Humaines Lignées établies Cultures primaires Cellules souches

9 Les virus Influenza Herpes Adenovirus Vaccins ou vecteurs de thérapie génique Vaccins - exemples: Influenza (GSK) Adénovirus 4 & 7 (Wyeth Pharma pour DoD, doses Aussi: variole, rubéole, rougeole, oreillons, varicelle, hépatite, polio, rage, fièvre jaune, encéphalite japonaise, cancer, etc

10 Maladies traitées par thérapie génique

11 Vecteurs utilisés

12 Type de gènes employés

13 Phases cliniques

14 La thérapie génique Adénovirus Rétrovirus La thérapie génique consiste à traiter une maladie par le transfert de matériel génétique. Les virus sont particulièrement bien adaptés pour accomplir cette tâche.

15 Adénovirus: cycle dinfection

16 Adénovirus: les gènes B Massie, IRB

17 Adénovirus: évolution des vecteurs B Massie, IRB

18 Adénovirus: construction R. Gilbert, IRB

19 Adénovirus: production et utilisation B Massie, IRB

20 Rétrovirus - Rétrovirus sinsère dans le génome de la cellule hôte - 3 familles de gènes: gag = capside, pol = polymérase, env = enveloppe - On manipule la protéine denveloppe pour altérer le tropisme du virus

21 Rétrovirus: cycle de réplication

22 Rétrovirus: construction de lignée de production

23 Les autres outils génétiques Diagnostic Patron de digestion par enzymes de restriction Séquençage Hybridation FISH Gene chip qRT-PCR Autres phénomènes Épigénétique ARNi

24 Techniques analytiques: Lidentification de séquences d'ADN La digestion de l'ADN avec des enzymes de restriction, suivi d'une électrophorèse permet une identification par la différence de taille des fragments Tiré de Microbiology 101, WSU

25 Lidentification de séquences (suite) En réalisant des PCR sur des fragments d'ADN en présence de désoxynucléotides et une alternance de didésoxynucléotides, on parvient à complètement séquencer l'ADN

26 Hybridation fluorescente in situ (FISH) LE FISH est une technique de biologie moléculaire d'hybridation in situ utilisant des sondes marquées à l'aide d'un marqueur fluorescent et utilisées sur des coupes en microscopie. Ces sondes peuvent être utilisées sur de l'ADN ou de l'ARN (sonde ADN), ou sur des protéines (sonde anticorps). Le FISH est une technique de cytogénétique permettant de voir des éléments à l'intérieur de la cellule.

27 L'expression des gènes: les biopuces 1- Comparaison de lexpression génétique de 2 échantillons cellulaires 2- Extraction de l ARN 3-Réverse transcription avec des nucléotides marqués par des fluorochromes différents 4- Hybridation compétitive sur des lamelles contenant des milliers doligonucléotides différents connus 5- Lecture des lamelles 6- Analyse des résultats

28 Les biopuces (suite) Joe DeRisi et al., Stanford U., 6116 gènes (cliquez sur les images pour une explication détaillée).

29 quantitative (RT)-PCR (qRT-PCR) Cliquez sur l'image pour un lien vers une simulation de la PCR

30 quantitative (RT)-PCR (qRT-PCR)

31 Épigénétique Le terme épigénétique définit les modifications transmissibles et réversibles de l'expression des gènes ne s'accompagnant pas de changements des séquences nucléotidiques. Les changements peuvent se produire spontanément, en réponse à l'environnement, à la présence d'un allèle particulier, même si celui-ci n'est plus présent dans les descendants Certains caractères épigénétiques hérités pouvaient être transmis lors de la réplication cellulaire (méiose), voire subsister d'une génération à l'autre pour des organismes multicellulaires. Les phénomènes épigénétiques constituent un programme qui déciderait quels gènes activer ou inhiber. Lenvironnement influence ces signaux épigénétiques qui peuvent ainsi subir de petits changements. Ces épimutations sont plus fréquentes que les mutations classiques de lADN. Phénomènes épigénétiques Paramutations Bookmarking Imprinting Gene silencing X chromosome inactivation Position effect Reprogramming Transvection Effet maternel

32 LARN anti-sens, interférent, micro-ARN (Pour plus de détails, cliquez ici)détails

33 Exemple 1: Infectio Diagnostic Originalement Infectio Diagnostic, puis GeneOhm Sciences et maintenant Becton Dickinson (BD) Diagnostics à Québec: Identification génétique de bactéries pathogènes, de gènes de toxines et de gènes de résistance (Strep B, SARM, …) Basé sur la sensibilité, la spécificité et l'ubiquité de l'amorce PCR Temps du test 1 hr

34 Exemple 2: Diagnocure La plate-forme technologique PCA3, un gène dont l'ARN messager est détecté dans la majorité des cancers de la prostate chez l'humain. Le même ARN messager n'est exprimé qu'à un très faible niveau dans la prostate normale et est absent des autres tissus normaux. PCA3 peut donc servir de marqueur tumoral et les molécules dérivées de sa séquence, ARN messager ou peptide, peuvent servir à la mise au point de divers produits de diagnostic ou de thérapie. La découverte du gène PCA3 est le fruit d'une collaboration entre DiagnoCure et l'Université de Nijmegen et DiagnoCure détient des droits mondiaux sur cette plate-forme technologique. La technologie DiagnoGeneMC est l'association de technologies pour la détection d'acides nucléiques et de séquences de gènes spécifiques au cancer. Les produits dérivés de cette plate-forme technologique contiennent trois trousses utilisées selon un protocole en trois phases. Une trousse contient des billes de silice pour la purification des acides nucléiques de la préparation cellulaire analysée. Une autre trousse contient des amorces, des séquences d'acides nucléiques spécifiques au cancer investigué, et les réactifs nécessaires à l'amplification isothermique des ARNs messagers isolés avec la première trousse et complémentaires aux amorces fournies. La troisième trousse sert à la détection immunoenzymatique du produit amplifié. Cette plate-forme technologique peut donc servir à la mise au point de trousses de détection de tout cancer pour lequel on connaît une séquence spécifique. Dans le cadre de l'accord de licence avec Organon Teknika, DiagnoCure détient des droits mondiaux sur les technologies Boom et NASBA, pour tous les cancers.

35 Les protéines recombinantes (PR) 1ère: insuline dans E. coli (1982, Ely Lilly) 73 sur le marché en 2004, >80 en essais cliniques Croissance de 65% entre 2004 et 2010 (52G$/2010) Insuline+EPO+IFN = 57% du marché Protéines glycosylées = 60% du marché des PR, principalement mAb

36 Les anticorps Les anticorps sont des protéines produites par le système immunitaire pour réagir avec un antigène donné. Ce sont des molécules de 150kDa, composées de 2 paires de polypeptides, lune de 25kD (chaîne courte, domaine variable), lautre de 50 kDa (chaîne longue, domaine constant). La chaîne courte est responsable de la spécificité de lanticorps pour son antigène

37 Anticorps monoclonaux - applications 37% des nouvelles molécules thérapeutiques biologiques Identification/diagnostic Thérapeutique: Contre cancer, Crohn, Asthme, Psoriasis, SIDA,... Dirigés contre une protéine spécifique, ils peuvent bloquer une interaction récepteur-ligand ou déclencher une réponse immunitaire. Ils peuvent aussi être liés à un agent chemothérapeutique, radioactif ou autre pour augmenter leur effet.

38 Exemple: Agent anti-angiogénétique (Laboratoires Aeterna) Le processus de langiogénèse, soit la formation de nouveaux vaisseaux, joue un rôle important dans le développement de la tumeur cancéreuse. Certains agents peuvent inhiber ce processus. Les agents isolés par Aeterna proviennent de laileron de requin. La prochaine étape consiste à isoler les gènes responsables de la synthèse de ces agents et de les cloner dans des micro-organismes.

39 Les cellules thérapeutiques Cellules du sang: cellules souches hématopoïétiques, Lymphocytes, Mégakaryocytes, plaquettes (Hema-Québec) Cellules musculaires (myoblastes, Jacques Tremblay, CHUL) Cellules épithéliales (peau, vaisseaux sanguins, Hopital du Saint- Sacrement, LOEX) Cellules souches d'adulte et embryonnaire (Réseau canadien sur les cellules souches, travaux sur le traitement du diabète, la maladie de Parkinson, l'insuffisance cardiaque, la dystrophie musculaire, la cécité, etc

40 Les cellules souches hématopoïétiques

41 Les cellules souches embryonnaires

42 Les cellules souches adultes

43 Dystrophie Musculaire de Duchenne (DMD) Prévalence: 1 garçon/3500 Espérance de vie 20 ans

44 Thérapie cellulaire de la DMD Essais cliniques phase 1 3x10 10 cellules/kg à traiter Équivalent: 100g muscle donneur /kg à traiter Multiplication in vitro incontournable Volumes de culture: 30L/kg à traiter Prérequis: Milieu de culture efficace et sécuritaire Bioprocédé à grande échelle (en développement)

45 Caractéristiques des protéines: épissage Source: U Miami, cours BIL150 Exemple: Nyman et al (1998), "Identification of nine interferon-a subtypes produced by Sendai virus induced human peripheral blood leucocytes". Biochem J, 329:

46 Caractéristiques des protéines: structure Thèse PhD, François GUILLONNEAU, 2002

47 Caractéristiques des protéines: les modifications post-traductionnelles Clivage Pont S méthylation, phosphorylation, glycosilation conformation ajout de ligands spécifiques (lipid anchor) Tiré de PHK

48 Analyses protéique et cellulaire Analyse de protéines activité ELISA Électrophorèse 1D, 2D, capillaire Chromatographie liquide (HPLC) Spectrométrie de masse Analyse cellulaire: Immuno-histo-chimie Cytométrie en flux Imagerie cellulaire en temps réel Systèmes robotisés

49 Enzyme-linked immunosorbent assay (ELISA)

50 Électrophorèse sur gel SDS-PAGE Transfert sur membrane de nitrocellulose et révélation avec marqueur spécifique: Western: EP + anticorps spécifiques à protéines Southern: EP + ADN marqué Northern: EP + ARN marqué

51 Tiré de Segura, Garnier et al (2007). Figure 2. Fractionation of purified retroviral vector preparations by 1D Gel Electrophoresis Purified virus preparations with (a) and without (b) subtilisin treatment were fractionated on a 4-12% Tris-Glycine polyacrylamide gel (Invitrogen) run under reducing conditions and visualized by silver staining. Protein bands from gel b were excised and subjected to in- gel tryptic digestion prior to MS/MS analysis. Bands containing statistically significant peptide identifications (A-L) are indicated on gel b. Figure 2c shows the protein profiles of samples a (green) and b (blue) superimposed. The theoretical migration positions of all MoMLV viral-encoded proteins are indicated in figure c. Électrophorèse SDS-PAGE

52 Gel délectrophorèse 2-D (Échantillon de sérum sanguin, Gygi et al., 2000)

53 High Pressure Liquid Chromatography (HPLC) Réservoir de Phase mobile Pompe Échantillon Colonne Échantilloneur Détecteur Collecteur de fraction Échange dions Tamis moléculaire Interaction hydrophobe Phase inverse Électrophorèse En fonction de la colonne Gradient UV/visible Fluorescence Infra-rouge Indice de réfraction Conductivité Spectrométrie de masse Automatique Réfrigéré

54 Hydrolysat trypsique de la BSA

55 Spectrométrie de masse (MS) - interface L'électro-atomisation (electro-spray ionisation, ESI) "Make elephants fly", Prix Nobel de Chimie 2002: John B Fenn

56 MS – domaines d'application L'électro-atomisation à pression atmosphérique (API-electrospray) permet l'analyse de protéines

57 MS - analyseurs Constitué de: 1)une source d'ionisation 2)un ou plusieurs analyseurs qui séparent les ions produits selon leur rapport m/z 3)un détecteur qui compte les ions et amplifie le signal 4)un système informatique pour traiter le signal Secteur magnétique

58 MS - Quadrupole m/z Précision :~m/z Vitesse de balayage: 5000 m/z par sec Le temps de vie dun ion de sa formation à sa détection ~ μs.

59 MS - Temps denvol (TOF) Lincorporation dun réflectron dans le tube du TOF ou une extraction ionique délayée (Cornish et Cotter, 1994; Cotter et al., 2004) TOF est communément employé avec MALDI, il peut aussi être utilisé avec un ESI (Boyle et Whitehouse, 1992)

60 LCMS – exemple d'appareil Agilent 1100 MSD: API-ES, quadrupole

61 MS – exemple de résultat Myoglobine, MM= Da Le résultat obtenu est un spectre de masse représentant les rapports m/z des ions détectés sur l'abscisse et l'abondance relative de ces ions sur l'ordonnée Le spectre est le résultat de la distribution de charges sur la population moléculaire Permet d'analyser qualitativement et quantitativement la protéine d'intérêt

62 Analyse de protéines par MSMS (Yates, 1998; Westermeier et Naven, 2002; Graves, 2002) MS spectrum MS/MS ion spectrum m/z Nomenclature de la dissociation en fragments proposée par Roepstorff, 1984

63 Exemple d'analyse MSMS Albumine Protéine majeure du sérum sanguin (20-30 g/L), souvent utilisée en milieu de culture de cellules de mammifères

64 Exemple d'analyse MSMS Albumine Informations obtenues sur Expasy (www.expasy.org) >P02769|ALBU_BOVIN Serum albumin - Bos taurus (Bovine). MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPF DEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEP ERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYY ANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVA RLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKE CCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRR HPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEK LGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLIL NRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLP DTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVV STQTALA Number of amino acids: 594 Molecular weight: Theoretical pI: 5.77

65 positionmasspeptide sequencepositionmasspeptide sequence ,2463DTHK ,5591ECCDKPLLEK ,3736SEIAHR ,4877SHCIAEVEK ,4577DLGEEHFK ,9596DAIPENLPPLTADFAEDK ,2427GLVLIAFSQYLQQCPFDEHVK ,3573NYQEAK ,6306LVNELTEFAK ,7427DAFLGSFLYEYSR ,546TCVADESHAGCEK ,7106HPEYAVSVLLR ,6722SLHTLFGDELCK ,5708EYEATLEECCAK ,3405VASLR ,6314DDPHACYSTVFDK ,4803ETYGDMADCCEK ,7161HLVDEPQNLIK ,3155QEPER ,42QNCDQFEK ,4509NECFLSHK ,7954LGEYGFQNALIVR ,4152DDSPDLPK ,8427VPQVSTPTLVEVSR ,7461LKPDPNTLCDEFK ,4499CCTKPESER ,282FWGK ,8131MPCTEDYLSLILNR ,4934YLYEIAR ,46LCVLHEK ,9268HPYFYAPELLYYANK ,3563TPVSEK ,6621YNGVFQECCQAEDK ,455CCTESLVNR ,4014GACLLPK ,8996RPCFSALTPDETYVPK ,3338IETMR ,2878AFDEK ,4097VLASSAR ,8993LFTFHADICTLPDTEK ,3338CASIQK ,6193QTALVELLK ,2514FGER ,3194HKPK ,3729AWSVAR ,4254ATEEQLK ,488AEFVEVTK ,6926TVMENFVAFVDK ,4716LVTDLTK ,2593CCAADDK ,5981ECCHGDLLECADDR ,4924EACFAVEGPK ,298ADLAK ,583LVVSTQTALA ,6206YICDNQDTISSK Albumine: fragments trypsiques

66 Analyse LC et MS1 de l'albumine trypsique ANALYSE MS2, cliquez ici Identification de protéine, cliquez ici (Logiciel Mascot, Matrix Science)

67 Protéomique du sérum sanguin Tirumalai et al., à 80 g/L de protéine (Tirumalai et al., 2003) protéines différentes 22 protéines = 99% de la quantité protéinique du sérum (Zhang et al., 2005) 12 log de variation de concentration (Anderson et Anderson, 2002; Zhang et al., 2005) 325 protéines identifiées en 2003 (Pieper et al., Proteomics, 3: ) 3020 protéines identifiées en 2005 (Omenn et al., Proteomics, 5:…)

68 Protéomique du sérum sanguin Anderson et Anderson, 2002

69 Analyse cellulaire Le compteur de Coulter enregistre un signal provoqué par une modification du champ électrique établi au travers dun orifice au travers duquel un fluide contenant les particules est aspiré. Ce signal est proportionnel au volume des particules. Exemple: distribution de tailles de particules pour deux échantillons différents

70 Immuno-histo-chimie Technique utilisant des anticorps spécifiques liés à des fluorochromes pour mettre en évidence une protéine présente sur une cellule ou un tissu. L'échantillon est par la suite observé en microscopie à fluorescence Distribution d'histones, de peroxisomes, et d'actine dans une culture de cellules Vero, Olympus

71 Cytométrie en flux Technique permettant d'analyser des cellules à grande vitesse en les faisant passer une à une dans le faisceau d'un laser. La lumière ré-émise (par diffusion ou fluorescence) permet de classer la population suivant plusieurs critères et de les trier.laser En anglais: Flow cytometry ou Fluorescence Assisted Cell Sorting (FACS)

72 Exemple de cytométrie en flux

73 Imagerie cellulaire en temps réel Chambre thermostatée, humidifiée et à concentration en CO 2 controlée, montée sur la platine du microscope Exemple: suivi de la division et de la polyploïdisation de cellules mégakaryocytaires sur 12 hrs (cliquez ici)

74 Sytèmes robotisés Composés: D'unités de gestion des liquides (Liquid handling stations) De bras robotisés D'incubateurs automatisés De lecteurs (Système Xiril, cliquez ici)

75 Développement de systèmes de production Établissement de lignées cellulaires Construction/sélection Procédés de production Procédés de séparation

76 Types de cellules animales Culture primaire: Culture initiale de cellules qui viennent dêtre prélevées dun tissu. Différenciée. Généralement à attachement obligatoire (ADC). Culture secondaire: Propagation dune culture primaire. Création dune lignée cellulaire. Peut être cultivé en suspension. Peut être indifférencié. Durée de vie limitée (30-50 divisions). Lignée immortelle ou stable. Lignée cellulaire transformée. Peut être cultivée en suspension. Durée de vie illimitée.

77 Différentes lignées MRC5, W138: secondaires, fibroblastes, poumons humains, adhérentes, vaccins HeLa: cancer cervical humain (Helen La...), stable, adhérentes, recherche CHO: ovaire de hamster chinois, stable, adhérente/suspension, versatile Vero: reins de singe verts africains, stable, adhérente, versatile Sf9, Spodoptera frugiperda, stable, système dexpression baculovirus HEK-293: embryon de rein humain, transformée par fragment dadénovirus, stable, hôte dadénovirus, adaptée à la suspension (293S)

78 Exemple: historique du développement de la lignée HEK-293 Graham, et al., J. Gen. Virol., 36:59-72, 1977

79 La construction d'un système d'expression – transformation/transfection/transduction Introduction d'ADN exogène sous la forme d'un plasmide dans des cellules procaryotes (transformation) ou eucaryotes (transfection) Les cellules manipulées pour accepter un ADN étranger sont dites compétentes Différentes méthodes: Phosphate de Calcium Liposomes Polycations (ex: polyéthylène imine, PEI; DEAE-Dextran) Électroporation Gene gun Transduction: introduction d'ADN exogène par le biais d'un virus (procaryote) STABLE OU TRANSITOIRE Access Excellence

80 La cassette d'expression Composé de un ou plusieurs gènes et des séquences contrôlant leur expression Promoteur (constitutif; inductible: lac, cumate, T, etc; tissu spécifique) Phase ouverte de lecture (Open reading frame) Séquence de polyadénylation (PolyA) Transactivateurs Gènes de résistance ou reporteur (LacZ, GFP, …) Des Internal Ribosome Entry Sites (IRES) peuvent être intercalés entre plusieurs ORFs

81 Autre exemple: la co-transfection dun plasmide et dun adénovirus dans la lignée cellulaire 293 pour produire un adénovirus recombinant: B. Massie, IRB

82 Sélection (Screening) Commencer par une expression transitoire Sélectionner en fonction: Résistance à l'agent de sélection Le niveau d'expression du gène reporteur ou de la protéine d'intérêt La stabilité de l'expression La qualité du produit (analyse crystalographique, RMN, MS, patrons de glycosylation, activité, stabilité, pharmacocinétique)

83 Les systèmes dexpression Bactéries (1-3 um) Levures Fungi Cellules animales (10-20 um) Modifications post- traductionnelles + poussées Produit plus stable Milieu de culture + complexe + grande fragilité des cellules Coûts + élevés Produits à + haute valeur ajoutée Critère de sélection: choisir le système le plus simple qui va faire le travail!

84 Exemple de milieu de culture de cellules de mammifères: Dulbecco Modified Eagle medium (DMEM) Sels (mg/L) CaCl Fe(NO 3 ) 3.9H 2 O0.10 KCl MgSO NaCl NaHCO NaH 2 PO 4.H 2 O Acides aminés (mg/L) Arginine84.00 Cystine.2HCl63.00 Glutamine Glycine30.00 Histidine42.00 Isoleucine Leucine Lysine.HCl Méthionine30.00 Phenylalanine66.00 Sérine Méthionine30.00 Phenylalanine66.00 Serine42.00 Thréonine95.00 Tryptophane16.00 Tyrosine.2Na.2H 2 O Valine94.00 Vitamines (mg/L) Ca.pantothénate4.00 Chlorure de choline4.00 Acide folique4.00 Inositol7.20 Niacinamide4.00 Riboflavine0.40 Thiamine.HCl4.00 Pyridoxine.HCl4.00 Autres (mg/L) Glucose Rouge de phénol15.00 Na.Pyruvate composants non-définis: sérum sanguin (5-15%), cocktail de facteurs de croissance, etc.

85 Comparaison des différents systèmes dexpression

86 Difficulté supplémentaire Temps de division augmente avec la taille: Les cellules animales nécessitent des conditions dasepsie très strictes Adhésion obligatoire: Certaines lignées de cellules de mammifères nécessitent un support pour être viables. Cela: pose un problème de mise à l échelle les rend particulièrement susceptibles au cisaillement Ex: tapis cellulaire de myoblastes Culture sur microporteurs

87 Exemple: Culture de myoblastes - test de différents microporteurs Boudreault, P., Tremblay, J.P., Pépin, M.F.,Garnier, A. (2001), "Scale-Up of a Myoblast Cell Culture Process". J. Biotechnol., 91 (1):63-74.

88 Culture de myoblastes - transfert de particule à particule Boudreault, P., Tremblay, J.P., Pépin, M.F.,Garnier, A. (2001), "Scale-Up of a Myoblast Cell Culture Process". J. Biotechnol., 91 (1):63-74.

89 La production Le bioréacteur Les paramètres Les cinétiques de croissance des micro-organismes et de production Les modes de production

90 Bioréacteurs Gracieuseté B.Braun Laboratoire doptimisation des bioprocédés (LOB, U. Laval)

91 Bioréaction: les paramètres Température pH composition du milieu Agitation Aération Asepsie

92 Contrôle des paramètres

93 Optimisation des paramètres

94 T=32°CT=35°CT=37°CT=39°C Effet de la température sur la production dadénovirus recombinant en 293S time (hpi) Relative titer Jardon et Garnier, 2000

95 Les cinétiques de croissance et de production Le modèle le plus simple: (bilan sur les cellules) (bilan sur le substrat) (cinétique de Monod) (modèle de Luedeking-Piret pour le produit) X: concentration cellulaire; S: concentration en substrat limitant; P: concentration en produit dintérêt; : taux spécifique de croissance; max et K s : paramètres de l expression de Monod; Y x/s : coefficient de rendement cellule/substrat;, : coefficient de la relation de Luedeking-Piret. S 0 et X 0, sont les concentrations en substrat et en cellules initialement. Xmax = Yx/s * S 0 +X 0. La solution

96 Simulation à partir dun modèle simple Cuvée, MAX = 1,16h -1, K S = 4 g/L, Y X/S = 0,5 g/g, = 0,4 g/g, = g/(g.h)

97 Autres cinétiques Inhibition par le substrat: Inhibition par le produit:...

98 Les modes dopération filtrat Perfusion Chemostat Cuvée-alimentée (fedbatch) Cuvée (batch) X, P

99 Culture en perfusion Figure 4. Fluorescence of 293S cells during infection with adenovirus:, Control;, B1 Perfusion 35 o C;, B2 Perfusion 35 o C;, B3 Perfusion 37 o C; X, T-flask. Cortin et al., 2002

100 Le traitement en aval (downstream processing) Les étapes séparation homogénéisation concentration purification

101 Séparation/Clarification Objectif: séparer les cellules du surnageant et conserver la fraction dintérêt selon que le produit est intracellulaire ou extracellulaire Les méthodes usuelles: centrifugation micro-filtration (0,1-0,45 um) Filtres à fibres creuses (AG tech) Principe de centrifugation en continu Grande échelle = filtration tangentielle

102 Homogénéisation Objectif: briser les cellules pour récupérer un produit intra-cellulaire Moyen: Gel/dégel Ultrason contraintes (stress) hydrodynamiques

103 Concentration Objectif: réduire le volume Moyens: Précipitation Ultra-centrifugation Ultra-filtration (5kDa - 500kDa) AG technologies

104 Purification Objectif: Isoler le produit dintérêt Moyen: chromatographie Access Excellence

105 Purification (suite) 3 types de chromatographie: Access Excellence

106 Le contrôle de qualité Les molécules biopharmaceutiques sont soumises aux mêmes normes que la fabrication de molécules de synthèse: Bonnes pratiques de fabrication (GMP) Protocoles dopération normalisés (SOP) Validation des procédés Documentation Ces normes sont appliquées de façon encore plus stricte pour les produits biologiques étant donné que les réactions menant à la formation du produit (le métabolisme cellulaire) ne sont pas bien définies.

107 Le contrôle de qualité (suite) Toute une série de normes, lignes directrices et de «points à considérer » sont émis par le « Center for Biologics Evaluation and Research » (CBER) de la Food &Drug Administration » (FDA) Les sections 210, 211 et 600 du titre 21 du "Code of Federal Regulations" (CFR) "Guidelines" et "point to consider » particulièrement pertinents: - "Guidance for Human Somatic Cell Therapy and Gene Therapy" - "Point to consider on Plasmid DNA Vaccines for Preventative Infectious Disease Indications" - A proposed Approach to the Regulation of Cellular and Tissue- based Products

108 Le contrôle de qualité (suite) Classent le processus de production GMP en 7 catégories: Installation Équipement Personnel Matériels Protocoles Tests Documentation


Télécharger ppt "BIOTECHNOLOGIE PHARMACEUTIQUE De léprouvette au produit final La totalité du matériel présenté est disponible à ladresse web:"

Présentations similaires


Annonces Google