La présentation est en train de télécharger. S'il vous plaît, attendez

La présentation est en train de télécharger. S'il vous plaît, attendez

BIOTECHNOLOGIE PHARMACEUTIQUE

Présentations similaires


Présentation au sujet: "BIOTECHNOLOGIE PHARMACEUTIQUE"— Transcription de la présentation:

1 BIOTECHNOLOGIE PHARMACEUTIQUE
De l’éprouvette au produit final PHA 2501: Sciences Pharmaceutiques II Alain Garnier, Laboratoire d’optimisation des bioprocédés (LOB), génie chimique, PROTEO, Hiver 2010 La totalité du matériel présenté est disponible à l’adresse web:

2 Définition et contexte
Biotechnologie: l’application de la science et de la technologie aux organismes vivants, à d’autres matériaux vivants ou non vivants, pour la production de savoir, biens et services. (source: OCDE) Traditionnelle: Utilisation de micro-organismes et d’enzymes sélectionnés pour produire des agents d’intérêt; Isolation d'agents à partir de sources biologiques. Contemporaine: Utilisation de micro-organismes et d’enzymes modifiés, directement ou non, pour produire des agents d’intérêt. Insérer diapo sur recombinaison génétique

3 Les médicaments d'origine biologique
Traditionnels: D'origine animale: produits sanguins, hormones, stéroïdes, catécholamines, prostaglandines, anticorps, insuline, vaccins… D'origine végétale: alcaloïdes, flavonoïdes, méthylxanthines, terpénoïdes, glycosides cardiotoniques et coumarines, ac salicylique… D'origine microbienne: antibiotiques, enzymes, protéases, vaccins, … D'origine virale: vaccins Stéroides: corticostéroides, corticoides, glucocorticoides

4 Les médicaments d'origine biologique (suite)
Biopharmaceutique: substance utilisée à des fins thérapeutiques ou diagnostiques, à base d'acides nucléiques ou de protéines, produites par des moyens autre que l'extraction directe d'une source biologique non-modifiée. Exemples: Facteurs sanguins (facteurs VIII et Factor IX) Agents trombolytiques (activateur tissulaire du plasminogène) Hormones (insuline, hormone de croissance, gonadotrophine, etc) Facteurs de croissance (cytokines, interférons (IFN), interleukines (IL), érythropoïétine (EPO), facteur de croissance des colonies, …) Vaccins (méningocoque, influenza, antigène de surface de l'hépatite B, …) Anticorps monoclonaux Autres (facteur de nécrose tumorale, plasmides, vecteurs viraux, microARN, ARNi, …) VIII et IX: coagulants

5 Seulement 12% des nouveaux médicaments sont produits par synthèse/extraction
% de médicaments approuvés ou en essais cliniques en 2000 (Odum, Pharma. Eng., 2001)

6 Plan Cibles Sources Produits/caractérisques Méthodes analytiques
Développement de systèmes de production Construction/sélection Procédés de production Procédés de séparation

7 Cibles des biopharmaceutiques
DIAGNOSTIC/THÉRAPIE Dépistage/ thérapie génique ADN Transcriptome/ ARNi ARN traduction Protéome/ Anticorps, hormones… PROTÉINE Syst immunitaire/vaccin Métabolisme/ Thérapie cellulaire Francis Crick, 1958 (source: NCBI)

8 Sources de biopharmaceutiques
Virus Bactéries Levures Moisissures Cellules animales Invertébrés Mammifères Primates non-humains Humaines Lignées établies Cultures primaires Cellules souches

9 Vaccins ou vecteurs de thérapie génique
Les virus Influenza Herpes Adenovirus Vaccins ou vecteurs de thérapie génique Vaccins - exemples: Influenza (GSK) Adénovirus 4 & 7 (Wyeth Pharma pour DoD, doses Aussi: variole, rubéole, rougeole, oreillons, varicelle, hépatite, polio, rage, fièvre jaune, encéphalite japonaise, cancer, etc Des vaccins " classiques "… Aujourd'hui, de nombreux vaccins (poliomyélite par voie orale, rougeole, rubéole, oreillons, fièvre jaune,…) sont constitués de micro-organismes vivants atténués, c'est à dire rendus non virulents, qui simulent une infection naturelle et déclenchent différentes réponses immunitaires. L'atténuation du pouvoir pathogène est obtenue par passage du micro-organisme sur des cultures cellulaires successives ou par voie chimique. Pour la plupart, ce sont des vaccins dirigés contre des virus car la mise au point de vaccins anti-bactériens atténués s'est révélée assez difficile. Il existe en fait un seul vaccin anti-bactérien de ce type largement utilisé chez l'homme : le vaccin contre la tuberculose ou B.C.G.(bacille de Calmette-Guérin). Une autre méthode " classique " de vaccination consiste à utiliser non plus des vaccins vivants atténués mais des vaccins à base de micro-organismes tués (inactivés) ou bien constitués de certains de leur composants purifiés. Ces micro-organismes tués doivent être capables eux aussi d'être reconnus par le système immunitaire. Plusieurs vaccins viraux de ce type sont actuellement commercialisés : contre la grippe, l'hépatite A, l'encéphalite japonaise, la poliomyélite (vaccin injectable) et la rage. La plupart des vaccins bactériens de première génération sont constitués de bactéries entières tuées : Salmonella typhi pour la typhoïde, le vibrion cholérique pour le choléra, Bordetella pertussis pour la coqueluche. Les vaccins contre la diphtérie et le tétanos sont quant à eux fondés sur l'obtention, par Gaston Ramon, à l'Institut Pasteur (1923), de protéines sécrétées par les bactéries, purifiées et traitées chimiquement pour leur faire perdre leur toxicité : les anatoxines. Ces molécules stimulent le système immunitaire et les anticorps produits contre elles peuvent neutraliser l'activité des vraies toxines bactériennes. On considère généralement que les vaccins vivants atténués sont plus efficaces. Ils agissent à faible dose et n'exigent en principe pas de rappel, de sorte qu'ils sont souvent bon marché. Mais ils ont aussi leurs limites. Tout d'abord, il n'est pas toujours possible d'atténuer la virulence d'un micro-organisme tout en lui conservant des capacités immunogènes. De plus, il peut arriver qu'un microbe atténué redevienne pathogène. Face à cela, le vaccin inactivé a l'avantage d'être plus sûr, mais il nécessite souvent d'être inoculé à des doses plus élevées et avec des rappels pour induire une bonne immunité à long terme. … aux nouvelles stratégies vaccinales Toute une variété de technologies issues du génie génétique permet désormais de concevoir des vaccins totalement nouveaux : vaccins vivants recombinants, vaccins sous-unités ou conjugués, vaccins à ADN ou ARN nu… On cherche ainsi à améliorer les vaccins existants et surtout à mettre au point des vaccins contre des maladies pour lesquelles rien n'est encore disponible. Différentes voies d'administration des vaccins, orale, nasale ou rectale par exemple, sont également à l'étude. Tiré de

10 Maladies traitées par thérapie génique

11 Vecteurs utilisés

12 Type de gènes employés

13 Phases cliniques

14 La thérapie génique Rétrovirus Adénovirus
La thérapie génique consiste à traiter une maladie par le transfert de matériel génétique. Les virus sont particulièrement bien adaptés pour accomplir cette tâche.

15 Adénovirus: cycle d’infection

16 Adénovirus: les gènes B Massie, IRB

17 Adénovirus: évolution des vecteurs
B Massie, IRB

18 Adénovirus: construction
R. Gilbert, IRB

19 Adénovirus: production et utilisation
B Massie, IRB

20 Rétrovirus - Rétrovirus s’insère dans le génome de la cellule hôte
- 3 familles de gènes: gag = capside, pol = polymérase, env = enveloppe - On manipule la protéine d’enveloppe pour altérer le tropisme du virus

21 Rétrovirus: cycle de réplication

22 Rétrovirus: construction de lignée de production

23 Les autres outils génétiques
Diagnostic Patron de digestion par enzymes de restriction Séquençage Hybridation FISH Gene chip qRT-PCR Autres phénomènes Épigénétique ARNi

24 Techniques analytiques: L’identification de séquences d'ADN
La digestion de l'ADN avec des enzymes de restriction, suivi d'une électrophorèse permet une identification par la différence de taille des fragments Tiré de Microbiology 101, WSU

25 L’identification de séquences (suite)
En réalisant des PCR sur des fragments d'ADN en présence de désoxynucléotides et une alternance de didésoxynucléotides, on parvient à complètement séquencer l'ADN

26 Hybridation fluorescente in situ (FISH)
LE FISH est une technique de biologie moléculaire d'hybridation in situ utilisant des sondes marquées à l'aide d'un marqueur fluorescent et utilisées sur des coupes en microscopie. Ces sondes peuvent être utilisées sur de l'ADN ou de l'ARN (sonde ADN), ou sur des protéines (sonde anticorps). Le FISH est une technique de cytogénétique permettant de voir des éléments à l'intérieur de la cellule.

27 L'expression des gènes: les biopuces
1- Comparaison de l’expression génétique de 2 échantillons cellulaires 2- Extraction de l ’ARN 3- Réverse transcription avec des nucléotides marqués par des fluorochromes différents 4- Hybridation compétitive sur des lamelles contenant des milliers d’oligonucléotides différents connus 5- Lecture des lamelles 6- Analyse des résultats

28 Les biopuces (suite) Joe DeRisi et al., Stanford U., 6116 gènes (cliquez sur les images pour une explication détaillée).

29 quantitative (RT)-PCR (qRT-PCR)
Cliquez sur l'image pour un lien vers une simulation de la PCR

30 quantitative (RT)-PCR (qRT-PCR)

31 Épigénétique Phénomènes épigénétiques Paramutations Bookmarking
Le terme épigénétique définit les modifications transmissibles et réversibles de l'expression des gènes ne s'accompagnant pas de changements des séquences nucléotidiques. Les changements peuvent se produire spontanément, en réponse à l'environnement, à la présence d'un allèle particulier, même si celui-ci n'est plus présent dans les descendants Certains caractères épigénétiques hérités pouvaient être transmis lors de la réplication cellulaire (méiose), voire subsister d'une génération à l'autre pour des organismes multicellulaires. Les phénomènes épigénétiques constituent un programme qui déciderait quels gènes activer ou inhiber. L’environnement influence ces signaux épigénétiques qui peuvent ainsi subir de petits changements. Ces épimutations sont plus fréquentes que les mutations classiques de l’ADN. Phénomènes épigénétiques Paramutations Bookmarking Imprinting Gene silencing X chromosome inactivation Position effect Reprogramming Transvection Effet maternel

32 L’ARN anti-sens, interférent, micro-ARN
(Pour plus de détails, cliquez ici)

33 Exemple 1: Infectio Diagnostic
Originalement Infectio Diagnostic, puis GeneOhm Sciences et maintenant Becton Dickinson (BD) Diagnostics à Québec: Identification génétique de bactéries pathogènes, de gènes de toxines et de gènes de résistance (Strep B, SARM, …) Basé sur la sensibilité, la spécificité et l'ubiquité de l'amorce PCR Temps du test ≈1 hr Les essais de IDI pour la détection spécifique de familles et de genres ont été validés pour leur spécificité, leur sensibilité et leur ubiquité. Ces essais démontrent une corrélation parfaite avec les méthodes biochimiques conventionnelles.  Bactérie, Famille: Enterobacteriaceae, Mycobacteriaceae, Pseudomonadaceae Genre: Clostridium, Corynebacterium, Enterococcus, Neisseria, Staphylococcus, Streptococcus. Champignons et Parasites, Famille: Trypanosomatidae, Genre: Candida, Entamoeba, Giardia, Leishmania, Trypanosom. Fondateur: Michel G Bergeron

34 Exemple 2: Diagnocure La plate-forme technologique PCA3, un gène dont l'ARN messager est détecté dans la majorité des cancers de la prostate chez l'humain. Le même ARN messager n'est exprimé qu'à un très faible niveau dans la prostate normale et est absent des autres tissus normaux. PCA3 peut donc servir de marqueur tumoral et les molécules dérivées de sa séquence, ARN messager ou peptide, peuvent servir à la mise au point de divers produits de diagnostic ou de thérapie. La découverte du gène PCA3 est le fruit d'une collaboration entre DiagnoCure et l'Université de Nijmegen et DiagnoCure détient des droits mondiaux sur cette plate-forme technologique. La technologie DiagnoGeneMC est l'association de technologies pour la détection d'acides nucléiques et de séquences de gènes spécifiques au cancer. Les produits dérivés de cette plate-forme technologique contiennent trois trousses utilisées selon un protocole en trois phases. Une trousse contient des billes de silice pour la purification des acides nucléiques de la préparation cellulaire analysée. Une autre trousse contient des amorces, des séquences d'acides nucléiques spécifiques au cancer investigué, et les réactifs nécessaires à l'amplification isothermique des ARNs messagers isolés avec la première trousse et complémentaires aux amorces fournies. La troisième trousse sert à la détection immunoenzymatique du produit amplifié. Cette plate-forme technologique peut donc servir à la mise au point de trousses de détection de tout cancer pour lequel on connaît une séquence spécifique. Dans le cadre de l'accord de licence avec Organon Teknika, DiagnoCure détient des droits mondiaux sur les technologies Boom et NASBA, pour tous les cancers.

35 Les protéines recombinantes (PR)
1ère: insuline dans E. coli (1982, Ely Lilly) 73 sur le marché en 2004, >80 en essais cliniques Croissance de 65% entre 2004 et 2010 (52G$/2010) Insuline+EPO+IFN = 57% du marché Protéines glycosylées = 60% du marché des PR, principalement mAb C’est en 1982 que la première protéine produite à partir d’un ADN exogène, l’insuline, fut autorisée à être commercialisée par la FDA (Food and Drug Administration). Depuis lors, le nombre de protéines recombinantes (PR) approuvées par la FDA ne cesse de croître (73 produits en 2004) et plus de 80 sont actuellement en essais cliniques. Avec 32 milliards de dollars, le secteur des PR représente aujourd’hui le noyau de l’industrie des Biotechnologies médicales. Les perspectives de croissance du secteur entre 2004 et 2010 sont estimées à 65% et le marché des PR devrait approcher les 52 milliards de dollars en A l’heure actuelle, les ventes d’insuline, d’interférons et d’érythropoïétine (EPO) représentent plus de 57% du marché soit 18 milliards de dollars [1-2]… A l’heure actuelle, le marché des protéines glycosylées représente 60% du marché des PR avec un taux annuel de croissance de 26%, les protéines non glycosylées représentent quant à elles 40% du marché des PR avec un taux annuel de croissance de 12% [33]. La croissance du marché des glycoprotéines coïncide avec la commercialisation en 1998 par Genentech du premier anticorps monoclonal (Abs) dirigé contre le cancer du sein (Herceptin). Depuis lors, le taux de croissance annuel des Abs est de 40%, et, selon plusieurs études économiques, les ventes d’Abs augmenteront pour atteindre plus de 16 milliards de dollars en [ ]. [1]. Pavlou K, Reichert JM. Recombinant protein therapeutics – success rates, market trends and values to 2010, Nature Biotechnology, 2004, vol 22, no 12, p 1513 – 1519 [2]. Walsh G. Biopharmaceuticals: recent approvals and likely directions. Trends in Biotechnology, 2006, vol 23, no6, p [33]. Gerngross TU. Advances in the production of human therapeutic proteins in yeast and filamentous fungi, Nature Biotechnology, 2004, vol 22, no 11, p [34]. Walsh G. Biopharmaceuticals: recent approvals and likely directions, Trends in Biotechnology, 2005, vol 23, no 11, p [35]. Reichert J, Pavlou A. Monoclonal antibodies market, Nature Biotechnology, 2004, vol 3, p [36]. Pavlou A, Belsey MJ. The therapeutic antibodies market to 2008, European Journal of Pharmaceutics and Biopharmaceutics, 2005, vol 59, p

36 Les anticorps Les anticorps sont des protéines produites par le système immunitaire pour réagir avec un antigène donné. Ce sont des molécules de 150kDa, composées de 2 paires de polypeptides, l’une de 25kD (chaîne courte, domaine variable), l’autre de 50 kDa (chaîne longue, domaine constant). La chaîne courte est responsable de la spécificité de l’anticorps pour son antigène

37 Anticorps monoclonaux - applications
37% des nouvelles molécules thérapeutiques biologiques Identification/diagnostic Thérapeutique: Contre cancer, Crohn, Asthme, Psoriasis, SIDA,... Dirigés contre une protéine spécifique, ils peuvent bloquer une interaction récepteur-ligand ou déclencher une réponse immunitaire. Ils peuvent aussi être liés à un agent chemothérapeutique, radioactif ou autre pour augmenter leur effet. THE AGE OF THE ANTIBODY HAS COMMENCED Antibody-based drugs, in particular monoclonal antibody-based products, are on the cusp of significant commercial growth. New developments are spurred in part by advances in technology that have now surmounted previous technical barriers to commercialization. According to a soon-to-be-released BUSINESS COMMUNICATIONS CO., INC., study RC-088U Antibody for Therapeutic and Diagnostic Imaging Applications, the total worldwide market is estimated at nearly $2.8 billion in 1999, and is forecast to grow to almost $9.8 billion in With the rollout of dozens of new antibody products and expanded indications for existing products expected during the forecast period, the AAGR (average annual growth rate) for this sector as a whole is projected at 21.8%. As of August 1999, there were 17 therapeutic and diagnostic monoclonal antibody products on the U.S. market. Worldwide, there were more than 700 monoclonal antibody products in development by more than 260 companies for the treatment of virtually every debilitating disease. Approximately 220 of these monoclonal antibody products were in clinical trials. According to the Pharmaceutical Research and Manufacturers of America (PhRMA), monoclonal antibody products represented approximately 37% of all biotechnology products in development by its members. Therapeutic applications represent over 99% of the market, and will grow at an average annual rate of 21.6% through the period, thereby growing from $3.6 million in 1999 to $9.7 million in 2004. Still in its inception stage in the late 90s, diagnostic-imaging applications will grow at a fast AAGR of nearly 50% to reach $196 million by 2004. This report analyzes and assesses therapeutic and in vivo diagnostic imaging applications of antibodies in human medicine. The document is intended to be comprehensive with respect to products as well as applications. The scope of the study is worldwide and provides a comprehensive analysis of the current markets for antibody drugs and, in particular, the market potential of promising drugs and technologies under development. Included are both polyclonal and monoclonal antibodies. Excluded are therapeutic and diagnostic imaging antibodies for veterinary use. Also excluded are in vitro immunoassay applications of antibodies.

38 Exemple: Agent anti-angiogénétique (Laboratoires Aeterna)
Le processus de l’angiogénèse, soit la formation de nouveaux vaisseaux, joue un rôle important dans le développement de la tumeur cancéreuse. Certains agents peuvent inhiber ce processus. Les agents isolés par Aeterna proviennent de l’aileron de requin. La prochaine étape consiste à isoler les gènes responsables de la synthèse de ces agents et de les cloner dans des micro-organismes.

39 Les cellules thérapeutiques
Cellules du sang: cellules souches hématopoïétiques, Lymphocytes, Mégakaryocytes, plaquettes (Hema-Québec) Cellules musculaires (myoblastes, Jacques Tremblay, CHUL) Cellules épithéliales (peau, vaisseaux sanguins, Hopital du Saint-Sacrement, LOEX) Cellules souches d'adulte et embryonnaire (Réseau canadien sur les cellules souches, travaux sur le traitement du diabète, la maladie de Parkinson, l'insuffisance cardiaque, la dystrophie musculaire, la cécité, etc

40 Les cellules souches hématopoïétiques

41 Les cellules souches embryonnaires

42 Les cellules souches adultes

43 Dystrophie Musculaire de Duchenne (DMD)
Prévalence: 1 garçon/3500 Espérance de vie ≈ 20 ans

44 Thérapie cellulaire de la DMD
Essais cliniques phase 1 3x1010 cellules/kg à traiter Équivalent: 100g muscle donneur /kg à traiter Multiplication in vitro incontournable Volumes de culture: 30L/kg à traiter Prérequis: Milieu de culture efficace et sécuritaire Bioprocédé à grande échelle (en développement)

45 Caractéristiques des protéines: épissage
Exemple: Nyman et al (1998), "Identification of nine interferon-a subtypes produced by Sendai virus induced human peripheral blood leucocytes". Biochem J, 329: Source: U Miami, cours BIL150

46 Caractéristiques des protéines: structure
Thèse PhD, François GUILLONNEAU, 2002

47 Caractéristiques des protéines: les modifications post-traductionnelles
Clivage Pont S méthylation, phosphorylation, glycosilation conformation ajout de ligands spécifiques (lipid anchor) Tiré de PHK

48 Analyses protéique et cellulaire
Analyse de protéines activité ELISA Électrophorèse 1D, 2D, capillaire Chromatographie liquide (HPLC) Spectrométrie de masse Analyse cellulaire: Immuno-histo-chimie Cytométrie en flux Imagerie cellulaire en temps réel Systèmes robotisés

49 Enzyme-linked immunosorbent assay (ELISA)

50 Électrophorèse sur gel
SDS-PAGE Transfert sur membrane de nitrocellulose et révélation avec marqueur spécifique: Western: EP + anticorps spécifiques à protéines Southern: EP + ADN marqué Northern: EP + ARN marqué

51 Électrophorèse SDS-PAGE
Tiré de Segura, Garnier et al (2007). Figure 2. Fractionation of purified retroviral vector preparations by 1D Gel Electrophoresis Purified virus preparations with (a) and without (b) subtilisin treatment were fractionated on a 4-12% Tris-Glycine polyacrylamide gel (Invitrogen) run under reducing conditions and visualized by silver staining. Protein bands from gel b were excised and subjected to in-gel tryptic digestion prior to MS/MS analysis. Bands containing statistically significant peptide identifications (A-L) are indicated on gel b. Figure 2c shows the protein profiles of samples a (green) and b (blue) superimposed. The theoretical migration positions of all MoMLV viral-encoded proteins are indicated in figure c.

52 Gel d’électrophorèse 2-D
(Échantillon de sérum sanguin, Gygi et al., 2000)

53 High Pressure Liquid Chromatography (HPLC)
Échange d’ions Tamis moléculaire Interaction hydrophobe Phase inverse Électrophorèse Automatique Réfrigéré Échantilloneur Réservoir de Phase mobile Pompe Colonne Détecteur Échantillon Collecteur de fraction En fonction de la colonne Gradient UV/visible Fluorescence Infra-rouge Indice de réfraction Conductivité Spectrométrie de masse

54 Hydrolysat trypsique de la BSA

55 Spectrométrie de masse (MS) - interface
L'électro-atomisation (electro-spray ionisation, ESI) "Make elephants fly", Prix Nobel de Chimie 2002: John B Fenn

56 MS – domaines d'application
L'électro-atomisation à pression atmosphérique (API-electrospray) permet l'analyse de protéines

57 MS - analyseurs Secteur magnétique Constitué de:
une source d'ionisation un ou plusieurs analyseurs qui séparent les ions produits selon leur rapport m/z un détecteur qui compte les ions et amplifie le signal un système informatique pour traiter le signal Secteur magnétique

58 MS - Quadrupole m/z 10-4000 Précision :~m/z 0.1-0.2
Vitesse de balayage: 5000 m/z par sec Le temps de vie d’un ion de sa formation à sa détection ~ μs.

59 MS - Temps d’envol (TOF)
L’incorporation d’un réflectron dans le tube du TOF ou une extraction ionique délayée (Cornish et Cotter, 1994; Cotter et al., 2004) TOF est communément employé avec MALDI, il peut aussi être utilisé avec un ESI (Boyle et Whitehouse, 1992)

60 LCMS – exemple d'appareil
Agilent 1100 MSD: API-ES, quadrupole

61 MS – exemple de résultat
Myoglobine, MM= Da Le résultat obtenu est un spectre de masse représentant les rapports m/z des ions détectés sur l'abscisse et l'abondance relative de ces ions sur l'ordonnée Le spectre est le résultat de la distribution de charges sur la population moléculaire Permet d'analyser qualitativement et quantitativement la protéine d'intérêt

62 Analyse de protéines par MSMS
MS spectrum MS/MS ion spectrum m/z Nomenclature de la dissociation en fragments proposée par Roepstorff, 1984 (Yates, 1998; Westermeier et Naven, 2002; Graves, 2002)

63 Exemple d'analyse MSMS Albumine
Protéine majeure du sérum sanguin (20-30 g/L), souvent utilisée en milieu de culture de cellules de mammifères

64 Exemple d'analyse MSMS Albumine
>P02769|ALBU_BOVIN Serum albumin - Bos taurus (Bovine). MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPF DEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEP ERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYY ANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVA RLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKE CCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRR HPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEK LGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLIL NRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLP DTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVV STQTALA Number of amino acids: 594 Molecular weight: Theoretical pI: 5.77 Informations obtenues sur Expasy (www.expasy.org)

65 Albumine: fragments trypsiques
position mass peptide sequence 25-28 500,2463 DTHK 1177,5591 ECCDKPLLEK 29-34 712,3736 SEIAHR 1015,4877 SHCIAEVEK 37-44 974,4577 DLGEEHFK 1955,9596 DAIPENLPPLTADFAEDK 45-65 2435,2427 GLVLIAFSQYLQQCPFDEHVK 752,3573 NYQEAK 66-75 1163,6306 LVNELTEFAK 1567,7427 DAFLGSFLYEYSR 76-88 1349,546 TCVADESHAGCEK 1283,7106 HPEYAVSVLLR 89-100 1362,6722 SLHTLFGDELCK 1388,5708 EYEATLEECCAK 545,3405 VASLR 1497,6314 DDPHACYSTVFDK 1364,4803 ETYGDMADCCEK 1305,7161 HLVDEPQNLIK 658,3155 QEPER 1011,42 QNCDQFEK 977,4509 NECFLSHK 1479,7954 LGEYGFQNALIVR 886,4152 DDSPDLPK 1511,8427 VPQVSTPTLVEVSR 1519,7461 LKPDPNTLCDEFK 1052,4499 CCTKPESER 537,282 FWGK 1667,8131 MPCTEDYLSLILNR 927,4934 YLYEIAR 841,46 LCVLHEK 1888,9268 HPYFYAPELLYYANK 660,3563 TPVSEK 1633,6621 YNGVFQECCQAEDK 1024,455 CCTESLVNR 701,4014 GACLLPK 1823,8996 RPCFSALTPDETYVPK 649,3338 IETMR 609,2878 AFDEK 703,4097 VLASSAR 1850,8993 LFTFHADICTLPDTEK CASIQK 1014,6193 QTALVELLK 508,2514 FGER 509,3194 HKPK 689,3729 AWSVAR 818,4254 ATEEQLK 922,488 AEFVEVTK 1399,6926 TVMENFVAFVDK 789,4716 LVTDLTK 725,2593 CCAADDK 1578,5981 ECCHGDLLECADDR 1050,4924 EACFAVEGPK 517,298 ADLAK 1002,583 LVVSTQTALA 1386,6206 YICDNQDTISSK

66 Analyse LC et MS1 de l'albumine trypsique
ANALYSE MS2, cliquez ici Identification de protéine, cliquez ici (Logiciel Mascot, Matrix Science)

67 Protéomique du sérum sanguin
60 à 80 g/L de protéine (Tirumalai et al., 2003) protéines différentes 22 protéines = 99% de la quantité protéinique du sérum (Zhang et al., 2005) 12 log de variation de concentration (Anderson et Anderson, 2002; Zhang et al., 2005) 325 protéines identifiées en (Pieper et al., Proteomics, 3: ) 3020 protéines identifiées en (Omenn et al., Proteomics, 5:…) Tirumalai et al., 2003

68 Protéomique du sérum sanguin
Anderson et Anderson, 2002

69 Analyse cellulaire Le compteur de Coulter enregistre un signal provoqué par une modification du champ électrique établi au travers d’un orifice au travers duquel un fluide contenant les particules est aspiré. Ce signal est proportionnel au volume des particules. Exemple: distribution de tailles de particules pour deux échantillons différents

70 Immuno-histo-chimie Technique utilisant des anticorps spécifiques liés à des fluorochromes pour mettre en évidence une protéine présente sur une cellule ou un tissu. L'échantillon est par la suite observé en microscopie à fluorescence Distribution d'histones, de peroxisomes, et d'actine dans une culture de cellules Vero, Olympus

71 Cytométrie en flux Technique permettant d'analyser des cellules à grande vitesse en les faisant passer une à une dans le faisceau d'un laser. La lumière ré-émise (par diffusion ou fluorescence) permet de classer la population suivant plusieurs critères et de les trier. En anglais: Flow cytometry ou Fluorescence Assisted Cell Sorting (FACS)

72 Exemple de cytométrie en flux

73 Imagerie cellulaire en temps réel
Chambre thermostatée, humidifiée et à concentration en CO2 controlée, montée sur la platine du microscope Exemple: suivi de la division et de la polyploïdisation de cellules mégakaryocytaires sur 12 hrs (cliquez ici)

74 Sytèmes robotisés Composés:
D'unités de gestion des liquides (Liquid handling stations) De bras robotisés D'incubateurs automatisés De lecteurs (Système Xiril, cliquez ici)

75 Développement de systèmes de production
Établissement de lignées cellulaires Construction/sélection Procédés de production Procédés de séparation

76 Types de cellules animales
Culture primaire: Culture initiale de cellules qui viennent d’être prélevées d’un tissu. Différenciée. Généralement à attachement obligatoire (ADC). Culture secondaire: Propagation d’une culture primaire. Création d’une lignée cellulaire. Peut être cultivé en suspension. Peut être indifférencié. Durée de vie limitée (30-50 divisions). Lignée immortelle ou stable. Lignée cellulaire transformée. Peut être cultivée en suspension. Durée de vie illimitée.

77 Différentes lignées MRC5, W138: secondaires, fibroblastes, poumons humains, adhérentes, vaccins HeLa: cancer cervical humain (Helen La...), stable, adhérentes, recherche CHO: ovaire de hamster chinois, stable, adhérente/suspension, versatile Vero: reins de singe verts africains, stable, adhérente, versatile Sf9, Spodoptera frugiperda, stable, système d’expression baculovirus HEK-293: embryon de rein humain, transformée par fragment d’adénovirus, stable, hôte d’adénovirus, adaptée à la suspension (293S)

78 Exemple: historique du développement de la lignée HEK-293
Graham, et al., J. Gen. Virol., 36:59-72, 1977

79 La construction d'un système d'expression – transformation/transfection/transduction
Introduction d'ADN exogène sous la forme d'un plasmide dans des cellules procaryotes (transformation) ou eucaryotes (transfection) Les cellules manipulées pour accepter un ADN étranger sont dites compétentes Différentes méthodes: Phosphate de Calcium Liposomes Polycations (ex: polyéthylène imine, PEI; DEAE-Dextran) Électroporation Gene gun Transduction: introduction d'ADN exogène par le biais d'un virus (procaryote) STABLE OU TRANSITOIRE Access Excellence

80 La cassette d'expression
Composé de un ou plusieurs gènes et des séquences contrôlant leur expression Promoteur (constitutif; inductible: lac, cumate, T, etc; tissu spécifique) Phase ouverte de lecture (Open reading frame) Séquence de polyadénylation (PolyA) Transactivateurs Gènes de résistance ou reporteur (LacZ, GFP, …) Des Internal Ribosome Entry Sites (IRES) peuvent être intercalés entre plusieurs ORFs

81 Autre exemple: la co-transfection d’un plasmide et d’un adénovirus dans la lignée cellulaire 293 pour produire un adénovirus recombinant: B. Massie, IRB

82 Sélection (Screening)
Commencer par une expression transitoire Sélectionner en fonction: Résistance à l'agent de sélection Le niveau d'expression du gène reporteur ou de la protéine d'intérêt La stabilité de l'expression La qualité du produit (analyse crystalographique, RMN, MS, patrons de glycosylation, activité, stabilité, pharmacocinétique)

83 Les systèmes d’expression
Modifications post-traductionnelles + poussées Produit plus stable Milieu de culture + complexe + grande fragilité des cellules Coûts + élevés Produits à + haute valeur ajoutée Bactéries (1-3 um) Levures Fungi Cellules animales (10-20 um) Critère de sélection: choisir le système le plus simple qui va faire le travail!

84 Exemple de milieu de culture de cellules de mammifères: Dulbecco Modified Eagle medium (DMEM)
Sels (mg/L) CaCl Fe(NO3)3.9H2O 0.10 KCl MgSO NaCl NaHCO NaH2PO4.H2O Acides aminés (mg/L) Arginine 84.00 Cystine.2HCl 63.00 Glutamine Glycine 30.00 Histidine 42.00 Isoleucine Leucine Lysine.HCl Méthionine 30.00 Phenylalanine 66.00 Sérine Méthionine 30.00 Phenylalanine 66.00 Serine 42.00 Thréonine 95.00 Tryptophane 16.00 Tyrosine.2Na.2H2O Valine 94.00 Vitamines (mg/L) Ca.pantothénate 4.00 Chlorure de choline 4.00 Acide folique 4.00 Inositol 7.20 Niacinamide 4.00 Riboflavine 0.40 Thiamine.HCl 4.00 Pyridoxine.HCl 4.00 Autres (mg/L) Glucose Rouge de phénol 15.00 Na.Pyruvate + composants non-définis: sérum sanguin (5-15%), cocktail de facteurs de croissance, etc.

85 Comparaison des différents systèmes d’expression

86 Difficulté supplémentaire
Temps de division augmente avec la taille: Les cellules animales nécessitent des conditions d’asepsie très strictes Adhésion obligatoire: Certaines lignées de cellules de mammifères nécessitent un support pour être viables. Cela: pose un problème de mise à l ’échelle les rend particulièrement susceptibles au cisaillement Ex: tapis cellulaire de myoblastes Culture sur microporteurs

87 Exemple: Culture de myoblastes - test de différents microporteurs
Boudreault, P., Tremblay, J.P., Pépin, M.F.,Garnier, A. (2001), "Scale-Up of a Myoblast Cell Culture Process". J. Biotechnol., 91 (1):63-74.

88 Culture de myoblastes - transfert de particule à particule
Boudreault, P., Tremblay, J.P., Pépin, M.F.,Garnier, A. (2001), "Scale-Up of a Myoblast Cell Culture Process". J. Biotechnol., 91 (1):63-74.

89 La production Le bioréacteur Les paramètres
Les cinétiques de croissance des micro-organismes et de production Les modes de production

90 Laboratoire d’optimisation des bioprocédés (LOB, U. Laval)
Bioréacteurs Laboratoire d’optimisation des bioprocédés (LOB, U. Laval) Gracieuseté B.Braun

91 Bioréaction: les paramètres
Température pH composition du milieu Agitation Aération Asepsie

92 Contrôle des paramètres
Lecture RPM T O2N2 Air CO2 pH O2 F

93 Optimisation des paramètres

94 Effet de la température sur la production d’adénovirus recombinant en 293S
20 40 60 80 100 time (hpi) Relative titer T=32°C T=35°C T=37°C T=39°C Jardon et Garnier, 2000

95 Les cinétiques de croissance et de production
Le modèle le plus simple: (bilan sur les cellules) (cinétique de Monod) (bilan sur le substrat) (modèle de Luedeking-Piret pour le produit) La solution X: concentration cellulaire; S: concentration en substrat limitant; P: concentration en produit d’intérêt; : taux spécifique de croissance; max et Ks: paramètres de l ’expression de Monod; Yx/s: coefficient de rendement cellule/substrat; , : coefficient de la relation de Luedeking-Piret. S0 et X0, sont les concentrations en substrat et en cellules initialement. Xmax = Yx/s * S0+X0.

96 Simulation à partir d’un modèle simple
Cuvée, MAX = 1,16h-1, KS = 4 g/L, YX/S = 0,5 g/g,  = 0,4 g/g,  = g/(g.h)

97 Autres cinétiques Inhibition par le substrat:
Inhibition par le produit: ...

98 Les modes d’opération X, P Cuvée (batch) Cuvée-alimentée (fedbatch)
Chemostat filtrat Perfusion X, P

99 Culture en perfusion Figure 4. Fluorescence of 293S cells during infection with adenovirus: , Control; , B1 Perfusion 35oC; , B2 Perfusion 35oC; , B3 Perfusion 37oC; X, T-flask. Cortin et al., 2002

100 Le traitement en aval (downstream processing)
Les étapes séparation homogénéisation concentration purification

101 Séparation/Clarification
Objectif: séparer les cellules du surnageant et conserver la fraction d’intérêt selon que le produit est intracellulaire ou extracellulaire Les méthodes usuelles: centrifugation micro-filtration (0,1-0,45 um) Filtres à fibres creuses (AG tech) Grande échelle = filtration tangentielle Principe de centrifugation en continu

102 Homogénéisation Objectif: briser les cellules pour récupérer un produit intra-cellulaire Moyen: Gel/dégel Ultrason contraintes (stress) hydrodynamiques

103 Concentration Objectif: réduire le volume Moyens: Précipitation
Ultra-centrifugation Ultra-filtration (5kDa - 500kDa) AG technologies

104 Purification Objectif: Isoler le produit d’intérêt
Moyen: chromatographie Access Excellence

105 3 types de chromatographie:
Purification (suite) 3 types de chromatographie: Access Excellence

106 Le contrôle de qualité Les molécules biopharmaceutiques sont soumises aux mêmes normes que la fabrication de molécules de synthèse: Bonnes pratiques de fabrication (GMP) Protocoles d’opération normalisés (SOP) Validation des procédés Documentation Ces normes sont appliquées de façon encore plus stricte pour les produits biologiques étant donné que les réactions menant à la formation du produit (le métabolisme cellulaire) ne sont pas bien définies.

107 Le contrôle de qualité (suite)
Toute une série de normes, lignes directrices et de «points à considérer » sont émis par le « Center for Biologics Evaluation and Research » (CBER) de la Food &Drug Administration » (FDA) Les sections 210, 211 et 600 du titre 21 du "Code of Federal Regulations" (CFR) "Guidelines" et "point to consider » particulièrement pertinents: "Guidance for Human Somatic Cell Therapy and Gene Therapy" "Point to consider on Plasmid DNA Vaccines for Preventative Infectious Disease Indications" A proposed Approach to the Regulation of Cellular and Tissue-based Products

108 Le contrôle de qualité (suite)
Classent le processus de production GMP en 7 catégories: Installation Équipement Personnel Matériels Protocoles Tests Documentation


Télécharger ppt "BIOTECHNOLOGIE PHARMACEUTIQUE"

Présentations similaires


Annonces Google