La présentation est en train de télécharger. S'il vous plaît, attendez

La présentation est en train de télécharger. S'il vous plaît, attendez

Analyse bio-instrumentale A. Garnier GCH-2100 A-2013.

Présentations similaires


Présentation au sujet: "Analyse bio-instrumentale A. Garnier GCH-2100 A-2013."— Transcription de la présentation:

1 Analyse bio-instrumentale A. Garnier GCH-2100 A-2013

2 Mise en contexte Problème réel: Quantifier la production en adénovirus recombinant, produit par culture de HEK- 293S – Dynamique de la production – Méthodes standards longues, fastidieuses et peu précises. – Méthode indirecte, 1ère génération: suivre la protéine dintérêt (ici la PTP1C) – Méthode de 2ème génération: suivre lexpression dun gène rapporteur (ici la « green fluorescent protein », GFP) suite à une infection secondaire, puis mesure au (fluorescence assisted cell sorter » (FACS: directe ou indirecte?

3 Titration virale: Méthode de plage de lyse

4 FACS

5 Fluorescence

6 Généralisation Lutilisation de gènes rapporteurs (reporter genes) est très fréquente: – GFP, lac Z (le gène de la -galactosidase, gène de la luciférase) Distinction importante entre méthode directe et indirecte – Appliquer au cas de la mesure de la concentration en micro-organismes

7 Méthodes directes pour la biomasse Masse sèche (filtration)(filtration) Dénombrement: – Hemacymètre – Coulter Coulter – FACS Avantages et inconvénients Autres méthodes directes: utilisation de colorants, CFU, dilutions limites…

8 Quelle est la précision des méthodes basées sur le dénombrement Rappel de la loi de Poisson: – x: nb dévènements quelconques observés dans un espace dimensionnel quelconque – n: espérance de x – espace dimensionnel peut être le temps, une longueur, une surface, un volume, etc Alors:

9 Exemple classique: le standard téléphonique Un standard reçoit en moyenne 60 appels/h. quelle est la probabilité quil reçoive 0, 1, 2, 3, etc appels durant la prochaine minute? n = 1 appel/minute x = 0, 1, 2, 3, etc P(0,1) = exp(-1)*1 0 / 0! = 0,368 P(1,1) = exp(-1)*1 1 / 1! = 0,368 P(2,1) = exp(-1)*1 2 / 2! = 0,184 P(3,1) = exp(-1)*1 3 / 3! = 0,06 …..

10 Pr(x,1) vs x, pour n=1

11 Pr(x,100) vs x +/- 10%

12 Écart-type de la loi de Poisson É.-t. ( )= n 1/2 Estimation de lé.-t. (s) = x 1/2 Estimation de lé.-t. relatif: s/x = x -1/2 Indication pour le dénombrement: – Limite inférieure: évènements – Limite supérieure: « comptabilité »!

13 Autre application de la loi de Poisson: dilutions limites Ex: concentration dun échantillon en micro-organismes =10 7 cellules/mL 7 éprouvettes contenant chacune 9 mL de milieu de culture stérile, inoculées, laissées à incuber 1 mL déchantillon 1/10 ? 9 ml Milieux initialement stériles

14 On peut calculer la probabilité que P(x>0,n)

15 Dilutions limites répétées (ex préc.) 1 mL déchantillon 1/10 1 mL déchantillon 1/10 1 mL déchantillon 1/10 1 mL déchantillon 1/10 1 mL déchantillon 1/10 P(x>0,n)=3/5 n1 X = 10 7 !!!

16 Méthodes indirectes de détermination de la concentration en micro-organismes Densité optique: – Turbidité: 545 nm – Labsorption lumineuse peut également servir à déterminer la concentration en: – Protéines: 214nm (lien peptidique), 280nm (aromatiques: Tyr, Trp, Phe) – ADN: 260 nm Fluorescence…

17 Autres mesures du déroulement dun procédé de bioproduction Nutriments: sucres, ac. aminés, vitamines, O 2 Constituants cellulaires: ADN, protéines, ARN (gene chip) Sous-produits métaboliques: acides organiques, alcools, ammoniaque, CO 2 Produit dintérêt Autres: pH, T, vitesse dagitation, viscosité, mousse, marqueurs cellulaires, etc

18 Composition cellulaire

19 Variation de la composition cellulaire

20 Méthodes Sondes: pH, OD, p CO2, T Tests enzymatiques, exemples: – Glucose par hexokinase(hk) (mesure de la fluorescence du NADH exc , ém ) : Glucose + ATP hk G6P + ADP G6P + NAD glucose-6-phosphate déshydrogénase (G6PDH) 6-PG +NADH – G6PDH par G6P G6P + NADP G6PDH 6-PG + NADPH

21 Méthodes (suite) Immuno-affinité: Anticorps-antigène

22 Enzyme-linked immunosorbent assay (ELISA)

23 La Réaction en chaîne par polymérase (PCR) Animation tirée du site du Réseau Lyonnais d'Ingénierie Éducative (RELIE), École Normale Supérieure de Lyon (cliquez sur le lien).

24 PCR en temps réel (real time)

25 Expression génétique Biopuces (cliquez sur une des images pour lanimation)

26 Séparation + détection Électrophorèse (SDS-PAGE) Western: EP + anticorps spécifiques à protéines Southern: EP + ADN marqué Northern: EP + ARN marqué

27 Tiré de Segura, Garnier et al (2007). Figure 2. Fractionation of purified retroviral vector preparations by 1D Gel Electrophoresis Purified virus preparations with (a) and without (b) subtilisin treatment were fractionated on a 4-12% Tris-Glycine polyacrylamide gel (Invitrogen) run under reducing conditions and visualized by silver staining. Protein bands from gel b were excised and subjected to in-gel tryptic digestion prior to MS/MS analysis. Bands containing statistically significant peptide identifications (A-L) are indicated on gel b. Figure 2c shows the protein profiles of samples a (green) and b (blue) superimposed. The theoretical migration positions of all MoMLV viral-encoded proteins are indicated in figure c. Électrophorèse SDS-PAGE

28 Gel délectrophorèse 2-D (Échantillon de sérum sanguin, Gygi et al., 2000) 2-DE des protéines soluble de levures

29 Séparation + détection = chromatographie Ex: High Pressure Liquid Chromatography (HPLC) Réservoir de Phase mobile Pompe Échantillon Colonne Échantilloneur Détecteur Collecteur de fraction Échange dions Tamis moléculaire Interaction hydrophobe Phase inverse Électrophorèse En fonction de la colonne Gradient UV/visible Fluorescence Infra-rouge Indice de réfraction Conductivité Spectrométrie de masse Automatique Réfrigéré

30 Exemple de HPLC (Agilent 1100)

31 Hydrolysat trypsique de la BSA

32 Chromatographie

33 Chromatographie (suite)

34 Temps de rétention: identification; surface sous le pic: quantification t M : temps délution de la phase mobile t R : temps de rétention t R : temps de rétention réduit = t R -t M k: facteur de fixation = t R /t M : écart-type dun pic gaussien : largeur du pic à mi-hauteur = 2,354 : largeur du pic à la base = 4 /t R : écart-type relatif N: efficacité de la colonne = (t R / ) 2 = 5,545 (t R / ) 2 = 16 (t R / ) 2 N: nb de plateau théorique H: hauteur de plateau théorique = L/N, où L: longueur de la colonne Exemple: 2 colonnes de 25 cm, 1 et 2 – t R1 = 416,4- t R2 = 481,2 – 1 = 10,2s- 2 = 13,2s Calculez N 1, N 2, h 1, h 2 identifiez la colonne la plus efficace

35 Chromatographie (suite) Pour 2 pics: – : facteur de sélectivité = t RB /t RA = k B /k A, où B est le pic le plus à droite – Pour phase stationnaire, phase mobile et T données, =constante – Résolution (R S )= t/ Exemple, 3 pics A, B et C: t M =83,4 s t R (A)= 195 s t R (B)= 415,4s t R (C)= 481,2 s Calculez B/A et C/B

36 Chromatographie (suite) Calcul de Résolution (R S ):

37 Spectroscopie de masse – arc magnétique

38 Spectrométrie de Masse - Quadrupole m/z Précision :~m/z Vitesse de balayage: 5000 m/z par sec Le temps de vie dun ion de sa formation a sa détection ~ μs.

39 Spectrométrie de Masse - Temps dEnvol (TOF) Lincorporation dun réflectron dans le tube du TOF ou une extraction ionique délayée (Cornish et Cotter, 1994; Cotter et al., 2004) TOF est communément employé avec MALDI, il peut aussi être utilisé avec un ESI (Boyle et Whitehouse, 1992)

40 Spectroscopie de masse 3 (GCMS)

41 Spectroscopie de masse 1

42 Spectroscopie de masse 4 (LCMS)

43 Tout est dans l'interface LC-MS L'electro-atomisation (electro-spray ionisation, ESI)

44 Exemple d'analyse MS Albumine Protéine majeure du sérum sanguin (20-30 g/L), souvent utilisé en milieu de culture de cellules de mammifères

45 Exemple d'analyse MS Albumine Informations obtenues sur Expasy >P02769|ALBU_BOVIN Serum albumin - Bos taurus (Bovine). MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPF DEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEP ERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYY ANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVA RLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKE CCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRR HPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEK LGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLIL NRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLP DTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVV STQTALA Number of amino acids: 594 Molecular weight: Theoretical pI: 5.77

46 Michaud et al (2008)

47 Spectrométrie de Masse – analyse de protéines par MSMS (Yates, 1998; Westermeier et Naven, 2002; Graves, 2002) MS spectrum MS/MS ion spectrum m/z Dissociation nomenclature fragment proposée par Roepstorff, 1984

48 positionmasspeptide sequencepositionmasspeptide sequence ,2463DTHK ,5591ECCDKPLLEK ,3736SEIAHR ,4877SHCIAEVEK ,4577DLGEEHFK ,9596DAIPENLPPLTADFAEDK ,2427GLVLIAFSQYLQQCPFDEHVK ,3573NYQEAK ,6306LVNELTEFAK ,7427DAFLGSFLYEYSR ,546TCVADESHAGCEK ,7106HPEYAVSVLLR ,6722SLHTLFGDELCK ,5708EYEATLEECCAK ,3405VASLR ,6314DDPHACYSTVFDK ,4803ETYGDMADCCEK ,7161HLVDEPQNLIK ,3155QEPER ,42QNCDQFEK ,4509NECFLSHK ,7954LGEYGFQNALIVR ,4152DDSPDLPK ,8427VPQVSTPTLVEVSR ,7461LKPDPNTLCDEFK ,4499CCTKPESER ,282FWGK ,8131MPCTEDYLSLILNR ,4934YLYEIAR ,46LCVLHEK ,9268HPYFYAPELLYYANK ,3563TPVSEK ,6621YNGVFQECCQAEDK ,455CCTESLVNR ,4014GACLLPK ,8996RPCFSALTPDETYVPK ,3338IETMR ,2878AFDEK ,4097VLASSAR ,8993LFTFHADICTLPDTEK ,3338CASIQK ,6193QTALVELLK ,2514FGER ,3194HKPK ,3729AWSVAR ,4254ATEEQLK ,488AEFVEVTK ,6926TVMENFVAFVDK ,4716LVTDLTK ,2593CCAADDK ,5981ECCHGDLLECADDR ,4924EACFAVEGPK ,298ADLAK ,583LVVSTQTALA ,6206YICDNQDTISSK Albumine: fragments trypsiques

49 Analyse LC et MS1 de l'albumine trypsique ANALYSE MS2, cliquez ici Identification de protéine, cliquez ici (Logiciel Mascot, Matrix Science)

50 Protéomique du sérum sanguin Tirumalai et al., à 80 g/L de protéine (Tirumalai et al., 2003) protéines différentes 22 protéines = 99% de la quantité protéinique du sérum (Zhang et al., 2005) 12 log de variation de concentration (Anderson et Anderson, 2002; Zhang et al., 2005)

51 Ex: protéomique du sérum sanguin Anderson et Anderson, 2002

52 Microscopie de cellules vivantes

53 Imagerie hyper-spectrale


Télécharger ppt "Analyse bio-instrumentale A. Garnier GCH-2100 A-2013."

Présentations similaires


Annonces Google