La présentation est en train de télécharger. S'il vous plaît, attendez

La présentation est en train de télécharger. S'il vous plaît, attendez

Bi 231: Ingénierie des Protéines cours 5. Plan Général I. Introduction et rappels. II. Purification des protéines. III. Surexpression d'une protéine.

Présentations similaires


Présentation au sujet: "Bi 231: Ingénierie des Protéines cours 5. Plan Général I. Introduction et rappels. II. Purification des protéines. III. Surexpression d'une protéine."— Transcription de la présentation:

1 Bi 231: Ingénierie des Protéines cours 5

2 Plan Général I. Introduction et rappels. II. Purification des protéines. III. Surexpression d'une protéine. IV. Mutagenèse: techniques et applications. V. L'insuline : exemple d'une stratégie. VI. Analyse d'articles.

3 V. L'insuline : exemple d'une stratégie. 51 –Introduction 52 –Historique : de Banting à Sanger 53 –Les stratégies utilisées.

4 51 –Introduction : Rôles, fonctionnement, structure et enjeux médicaux. Insuline : hormone sécrétée par le pancréas. sécrétée dans le sang après ingestion de sucres. provoque absorption du sucre par les cellules (médiée par des récepteurs spé).

5 Régulation de la glycémie chez les mammifères : Rôle + du glucagon relargage par le foie Rôle – de l'insuline Absorption cellulaire du glucose notamment par adipocytes

6 Diabète :déficience en insuline sans insuline problèmes majeurs d'assimilation du glucose au niveau cellulaire. Diabète de type I : déficit de production de l'insuline. Diabète de type II : problème de transduction du signal sur cellules réceptrices.

7 Diabète de type I Due à réaction auto- immune : Ac ilôts de Langerhans hyperglycémie coma mort 10% des diabétiques Apparition favorisée par infection par certains virus (EBV,...), traitement médicaux, chirurgicaux. Traitement : injection régulière d'insuline.

8 Diabète de type II Due à mauvaise alimentation + terrain génétique. hyperglycémie chronique problèmes cardiaques, visuels,rénaux, neurologiques,... 90% des diabétiques. Chez sujets adultes, agés Apparition multifactorielle : génétique, alimentaire, autoimmune (Ac insuline-recepteur),... Traitement : régime alimentaire, hygiène de vie +traitement médicamenteux.

9 Les différents types d'insuline disponibles : Analogues d'insuline : action rapide action prolongée Biphasique Onset: minutes Maximum effect: 1-3 hours Duration: 3-5 hours Onset: 1 hour Duration: 24 hours Onset: minutes Maximum effect: 1-4 hours Duration: up to 24 hours Insuline humaine: action rapide action intermédiaire prémixée Onset: within 30 minutes Maximum effect: 1-3 hours Duration: 8 hours indication : 30 min after meal Onset: within 1.5 hours Maximum effect: 4-12 hours Duration: 24 hours Onset: within 30 minutes Maximum effect: 2-8 hours Duration: 24 hours composition : 30% rapid, 70% isophane

10 Structure de l'insuline Formée de 2 chaînes, A et B synthétisée sous forme de proinsuline

11 Séquence de l'insuline Préproinsuline humaine peptide B :31 aapeptide A : 20 aa peptide signal peptide C FVNQHLCGSHLVEALYLVCGERGFFYTPKT D fSL RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR H L GIVEQCCTSICSLYQLENYCN L accumulation de proinsuline (F S diabète de type II)

12 Comparaison avec autres insulines animales

13 V. L'insuline : exemple d'une stratégie. 51 –Introduction sur Insuline : Rôles, fonctionnement, structure, enjeux médicaux. 52 –Historique : de Banting à Sanger 53 –Les stratégies utilisées.

14 52 –Historique : de Banting à Sanger : Ablation du pancréas induit un diabète chez le chien : Restauration de la glycémie par injection d'extrait de pancréas chez chien sans pancréas : Extraction d'une hormone antidiabétique simultanément par 2 équipes : Bucarest (Paulesco) Toronto (Banting & Macleod) : premiers patients traités et sauvés à Toronto 1923 : Banting & Macleod : prix Nobel de médecine : amélioration de la pureté et des formulations (1 ère insuline retard par ajout de Zn, protamine)

15 52 –Historique : de Banting à Sanger :cristallisation de l'insuline 1958 : détermination de la structure chimique de l'insuline (1 ère protéine séquencée): prix Nobel de chimie pour Sanger : Séquence de la proinsuline : Structure 3D de l'insuline. 197n : "humanisation" de l'insuline porcine : production d'insuline recombinante Amélioration du procédé

16 V. L'insuline : exemple d'une stratégie. 51 –Introduction sur Insuline : Rôles, fonctionnement, structure, enjeux médicaux. 52 –Historique : de Banting à Sanger 53 –Les stratégies utilisées.

17 53 –Les stratégies de purifications utilisées. A partir de pancréas : extraction acide dans éthanol et précipitation / sels. Conversion d'insuline porcine. Surproduction d'insuline. Surproduction de proinsuline.

18 A partir de pancréas Le pancréas est découpé en morceaux, Suspendu dans ethanol à pH 2 (inactivation de la trypsine), neutralisation / CaCO 3, précipitation par sels ( KCl, NaCl, SO 4 (NH 4 ) 2,... ), resuspension dans eau et précipitation par acidification + chromatographie : Gel filtration et/ou échangeuse d'ions

19 Conversion d'insuline porcine. = remplacement Ala Thr purification insuline (cf précédent), conversion : insuline (porc) + Trypsine + thréonine ester dans eau+solvant organique (diminue activité peptidase de trypsine et favorise la réaction inverse), rendement <97 % Purification par chromatographie(s)

20 Surproduction d'insuline. Production séparée des chaînes A et B chez E. coli. Les peptides étaient co-exprimés avec autre protéine ( -gal, TrpE,...). séparation /protéolyse 2A +1B sulfoné (cys-SO 2 ) + mercaptoethanol, 24H 60 % rendemment. purification / chromatographie phase inverse phase inverse

21 Surproduction de proinsuline. sur expression chez E. coli (1982) insertion du cDNA de la préproinsuline dans une vecteur bactérien. surproduction avec protéine de fusion (idem). coupure / protéase proinsuline oxydation des cystéines repliement de la protéine en présence de réducteurs. coupure par protéase spécifique purification par chromatographie

22 Surproduction de proinsuline. sur expression chez S. cerevisiae (1988) insertion du cDNA de la préproinsuline dans une vecteur de levure. surproduction avec protéine de fusion (idem). coupure / protéase proinsuline insuline purification par chromatographies


Télécharger ppt "Bi 231: Ingénierie des Protéines cours 5. Plan Général I. Introduction et rappels. II. Purification des protéines. III. Surexpression d'une protéine."

Présentations similaires


Annonces Google