La présentation est en train de télécharger. S'il vous plaît, attendez

La présentation est en train de télécharger. S'il vous plaît, attendez

Quelques mots sur la bioinfo Maude Pupin. Déroulement des 6 séances de TP : 5 séances de TP + un examen de TP sur l'ensemble. Banques de données (aujourd'hui)

Présentations similaires


Présentation au sujet: "Quelques mots sur la bioinfo Maude Pupin. Déroulement des 6 séances de TP : 5 séances de TP + un examen de TP sur l'ensemble. Banques de données (aujourd'hui)"— Transcription de la présentation:

1 Quelques mots sur la bioinfo Maude Pupin

2 Déroulement des 6 séances de TP : 5 séances de TP + un examen de TP sur l'ensemble. Banques de données (aujourd'hui) Comparaison de séquences Prédiction de gènes Annotation des protéines Reconstruction phylogénétique Sujets de TP accessibles depuis :

3 Quest-ce que la bioinformatique ? Lapproche in silico de la biologie Un outil indispensable aux biologistes Un nouveau domaine de recherche Trois activités principales : Acquisition et organisation des données biologiques Conception de logiciels pour lanalyse, la comparaison et la modélisation des données Analyse des résultats produits par les logiciels

4 Les limites de la bioinformatique Grands volumes de données à traiter Parfois diminution de la qualité des résultats au profit de la rapidité Recherche dune solution parmi un ensemble infini de possibilités Besoin doptimiser les programmes pour arriver à proposer un résultat dans un temps raisonnable Ce nest pas toujours la solution la meilleure qui est trouvée Dépendant des connaissances biologiques Un résultat de programme n'est pas une vérité !

5 Quelques liens utiles (en français) Deambulum à Infobiogen Recueil de liens vers des sites de biologie et bioinformatique Logiciels pour la biologie à lInstitut Pasteur De nombreux logiciels proposés et des liens vers des sites NPSA au PBIL (Pôle BioInformatique Lyonnais) Létude des protéines et autres logiciels Proteomics tools à Expasy Tout sur létude des protéines

6 Présentation des banques de données

7 Quest-ce quune banque de données ? Ensemble de données relatives à un domaine, organisées par traitement informatique, accessibles en ligne et à distance Souvent, les données sont stockées sous la forme dun fichier texte formaté (respectant une disposition particulière) Besoin de développer des logiciels spécifiques pour interroger les données contenues dans ces banques

8 Les banques de données généralistes Ces banques contiennent des données hétérogènes Collecte la plus exhaustive possible Banques de séquences nucléiques Banques de séquences protéiques Banques de structure 3D de macromolécules Banques darticles scientifiques Avantage : tout est consultable en une fois Inconvénients : difficiles à maintenir, difficiles à interroger

9 Les banques de données spécialisées Ces banques contiennent des données homogènes Collecte établie autour dune thématique particulière Avantages : facilité pour mettre à jour les données, vérifier leur intégrité, offrir une interface adaptée, … Inconvénients : ne cible pas toujours ce que lon veut; toutes les banques possibles nexistent pas Exemples : banques spécialisées pour un génome, banques de séquences d'immunologies, banques sur des séquences validées, …

10 Les banques de séquences nucléiques Origine des données : Séquençage dADN et dARN Les données stockées : séquences + annotations Fragments de génomes Un ou plusieurs gènes, un bout de gène, séquence intergénique, … Génomes complets ARNm, ARNt, ARNr, … (fragments ou entiers) [ Note 1] : toutes les séquences (ADN ou ARN) sont écrites avec des T [ Note 2] : les séquences sont toujours orientées 5 vers 3.

11 Développement du séquençage de lADN 1977 : F. Sanger met au point la méthode de Sanger pour établir le séquençage de lADN : Création de la banque EMBL 1984 : Développement de la réaction de polymérisation en chaîne (PCR) par Mullis : Réalisation et commercialisation du 1er séquenceur automatisé par la société Applied Biosystems (Californie).

12 Banques nucléiques, les débuts Apparition dans les années 1980 Toutes les séquences déterminées sont publiées dans un article Les banques guettent les articles et en extraient les séquences Croissance du nombre de séquences : Pas de publication systématique pour une séquence Beaucoup de données à collecter Gestion des données par des organismes spécialisés Les séquences et leurs annotations sont soumises aux banques par les laboratoires qui ont fait le séquençage

13 Banques nucléiques, le partage des données Trois banques : EMBL (European Molecular Biology Laboratory), crée en 1982 GenBank (banque des Etats-Unis dAmérique), crée en 1982 DDJ (DNA Databank of Japon), crée en 1986 Echange quotidien des données entre ces banques depuis 1987 (1992 ?) Répartition de la collecte des données Chaque banque collecte les données de son continent Même format de données pour la partie « Feature » Formats différents pour le reste de lentrée

14 Banques nucléiques, mises à jour de la banque Une nouvelle version est disponible plusieurs fois par an Date et numéro de version (release) Données figées à une date fixée (toutes les séquences collectées jusque là) Mise à disposition des « UpDates » Mise à jour quotidienne des données Toutes les nouvelles séquences depuis la dernière version Facilite le traitement des données Pas besoin de télécharger la banque entière tous les jours Possibilité de faire des calculs longs

15 Banques nucléiques, dernière version EMBL, version 85 du 30 novembre ,739,883 entrées, 116,106,677,726 bp Dont 12,088,383 entrées (59,629,958,692 bp) sont issues de « shutgun » GenBank, version 150 de février ,584,635 entrées, 59,750,386,305 bp DDBJ, version 62 de mai entrées, bp

16 Banques nucléiques, croissance

17 Séquençage de génomes 1995 : Séquençage de la 1ère bactérie, Haemophilus influenzae (1,83 Mb) (Fleischmann) : Séquençage du 1er génome eucaryote, Saccharomyces cerevisiae (12 Mb) (Dujon) : Séquençage du 1er organisme pluricellulaire, Caenorhabditis elegans (100 Mb) : Annonce du décryptage presque complet du génome humain (février).

18 Les projets de séquençage (source : GOLD) Source : GOLD (http://www.genomesonline.org/) 298 génomes complets publiés 236 bactéries 39 eucaryotes 23 archaebactéries 746 génomes procaryotes en cours de séquençage 706 bactéries 38 archaebactéries 531 génomes eucaryotes en cours de séquençage

19 Banques nucléiques, format dune entrée 3 parties : Chaque ligne commence par un mot-clé Deux lettres pour EMBL Maximum 12 lettres pour Genbank et DDBJ Fin dune entrée : // Description générale de la séquence « Features » Description des objets biologiques présents sur la séquence La séquence ctccggcagc ccgaggtcat cctgctagac tcagacctgg atgaacccat agacttgcgc 60 tcggtcaaga gccgcagcga ggccggggag ccgcccagct ccctccaggt gaagcccgag 120 acaccggcgt cggcggcggt ggcggtggcg gcggcagcgg cacccaccac gacggcggag 180

20 ID AF standard; genomic DNA; PRO; 948 BP. AC AF226511; SV AF DT 15-MAR-2000 (Rel. 63, Created) DT 04-JAN-2006 (Rel. 86, Last updated, Version 2) DE Neisseria meningitidis strain 1000 membrane protein GNA1220 (gna1220) gene, DE complete cds. OS Neisseria meningitidis OC Bacteria; Proteobacteria; Betaproteobacteria; Neisseriales; Neisseriaceae; OC Neisseria. RP RX DOI; /science RX PUBMED; RA Pizza M., Scarlato V., Masignani V., Giuliani M.M., Arico' B., … RT "Identification of vaccine candidates … " RL Science 287(5459): (2000). RL Submitted (19-JAN-2000) to the EMBL/GenBank/DDBJ databases. RL IRIS Immunobiological Research Institute in Siena, Chiron SpA, Via RL Fiorentina, 1, Siena 53100, Italy Description générale de la séquence

21 Banques nucléiques, les différentes lignes (1/2) ID : nom de lentrée, … Unique (propre à une entrée) Non permanent (peut changer au cours des versions) AC : numéro daccession Unique, plusieurs pour une même entrée (fusion dentrées) Permanent (ne disparaît jamais de la banque) SV : version de la séquence (Acc.version) DT : date dincorporation dans la banque et de dernière mise à jour DE : description du contenu de lentrée

22 Banques nucléiques, la ligne ID ID entryname dataclass; molecule; division; sequencelength BP. Exemple: ID AB standard; RNA; PRI; 368 BP. Entryname : nom de lentrée en général numéro d'accession Dataclass : toujours le mot « standard » Molecule : type de la molécule de lentrée DNA, RNA, circular DNA, … Division : essentiellement basé sur la taxonomie HUM (Human), MUS (Souris), MAM (Other Mammals),... Taille : en paires de bases

23 Banques nucléiques, les différentes lignes (2/2) KW : liste de mots-clés (désuet) OS : organisme doù provient la séquence (nom latin) OC : taxonomie (ou « artificial sequence ») Exemple : Eukaryota; Planta; Phycophyta; Euglenophyceae. OG : localisation de séquences non nucléaires Exemple : Mito, Plasmid … RA, RT, RN, RC, RX, RP, RL : réf. bibliographiques DR : liaison avec dautres banques de données FH, FT : caractéristiques dune entrée (Features) SQ : séquence (termine par //)

24 FH Key Location/Qualifiers FH FT source FT /db_xref="taxon:487" FT /mol_type="genomic DNA" FT /note="serogroup: B" FT /organism="Neisseria meningitidis" FT /strain="1000" FT gene FT /gene="gna1220" FT CDS FT /codon_start=1 FT /db_xref="GOA:Q9JPH5" FT /db_xref="InterPro:IPR001107" FT /db_xref="InterPro:IPR001972" FT /db_xref="UniProtKB/TrEMBL:Q9JPH5" FT /note="similar to stomatin-like proteins; Genome-derived FT Neisseria Antigen GNA1220" FT /transl_table=11 FT /gene="gna1220" FT /product="membrane protein GNA1220" FT /protein_id="AAF " FT /translation="MEFFIILLVAVAVFGFKSFVVIPQQEVHVVERLGRFHRALTAGLN FT ILIPFIDRVAYRHSLKEIPLDVPSQVCITRDNTQLTVDGIIYFQVTDPKLASYGSSNYI FT MAITQLAQTTLRSVIGRMELDKTFEERDEINSTVVSALDEAAGAWGVKVLRYEIKDLVP FT PQEILRSMQAQITAEREKRARIAESEGRKIEQINLASGQREAEIQQSEGEAQAAVNASN FT AEKIARINRAKGEAESLRLVAEANAEAIRQIAAALQTQGGADAVNLKIAEQYVAAFNNL FT AKESNTLIMPANVADIGSLISAGMKIIDSSKTAK" XX « Features » Description des objets biologiques présents sur la séquence

25 Banques nucléiques, Features But : Mettre à disposition un vocabulaire étendu pour décrire les caractéristiques biologiques des séquences. Format : Key : indique un groupe fonctionnel Vocabulaire contrôlé, hiérarchique Location : instructions pour trouver lobjet sur la séquence de lentrée Qualifiers : informations complémentaires /qualifier=commentaires libres

26 Banques nucléiques, Key (1/2) Mot-clé le plus général : misc_feature Changements dans la séquence : misc_difference,... Régions répétées : repeat_region,... Régions des Ig : immunoglobulin_related,... Structures secondaires : misc_structure stem_loop D-loop Régions impliquées dans la recombinaison : misc_recomb,...

27 Banques nucléiques, Key (2/2) gene misc_signal promoter CAAT_signal TATA_signal -35_signal -10_signal GC_signal RBS polyA_signal enhancer attenuator terminator misc_RNA prim_transcript precursor_RNA mRNA 5'clip 3'clip 5'UTR 3'UTR exon CDS intron polyA_site

28 Banques nucléiques, Location (1/2) 467base seule séquence comprise entre les bornes (incluses) < commence avant le premier nt de l'entrée < début réel inconnu, avant >888 finit après la position 888. ( )..888 position réelle inconnue, entre 228 et ^146situé entre deux nt adjacents

29 Banques nucléiques, Location (2/2) complement( ) séquence complémentaire inversée de celle de l'entrée Intervalle toujours donné avec la borne la plus petite en premier Indique que lobjet est sur lautre brin join(12..78, ) séquence unique composée des fragments indiqués concaténés Ex : ARNm mature constitué de plusieurs exons

30 Banques nucléiques, Qualifiers Vocabulaire contrôlé entre « / » et « = » puis texte libre Le vocabulaire dépend du Key au quel le Qualifier se réfère Nom de gène /gene= ou /name= Fonction de la protéine codée par le gène /product= Origine de lannotation /evidence= Texte libre /note=

31 Banques nucléiques, mise à jour des données Evolution des entrées Erreurs de séquences Changements dans les annotations Pb : Seuls les auteurs dune entrées peuvent la corriger ! Faible taux de mise à jour Création dune nouvelle banque : TPA Third Party Annotation Stockage à part de la mise à jour des entrées

32 Banques nucléiques, inconvénients Difficulté de mise à jour des données Version plus récente dune séquence ou dune annotation dans dautres banques (ex : banques dédiées à un génome complet) Forte redondance Un même fragment de séquence présent dans plusieurs entrées Annotations peu normalisées Difficulté de recherche dune information précise Annotations peu précises Peu de descriptions sur les gènes et leur produit Erreurs dans les annotations

33 Création de banques plus spécialisées, RefSeq Gérée au NCBI Séquences nucléiques et protéiques Liens explicites entre les gènes et leurs produits Chaque entrée représente une unique molécule dun organisme particulier Pas de redondance Mise à jour manuelle par le personnel du NCBI Validation des données et annotations normalisées Statut de lentrée indiqué sur chaque entrée (prédit, validé, …) Information sur les variants de transcrits

34 Création de banques plus spécialisées, UniGene Gérée au NCBI Regroupe les séquences nucléiques Comparaison des séquences de GenBank entre elles Création de groupes de séq similaires basés sur les gènes Une entrée : les séquences dérivées dun même gène Les différents ARNm connus, les EST, … Informations sur le gène, la protéine, lexpression

35 Les banques de séquences protéiques Origine des données Traduction de séquences dADN Séquençage de protéines Rare car long et coûteux Protéines dont la structure 3D est connue Les données stockées : séquences + annotations Protéines entières Fragments de protéines

36 Banques de séquences protéiques, les débuts 1965 : Atlas of Protein Sequences, Margaret Dayhoff 50 entrées Version papier jusquen 78, puis version électronique 1984 : création de PIR-NBRF (Protein Information Resource - National Biomedical Research Foundation) Collaboration avec MIPS (Allemagne) et JIPID (Japon) 1986 : création de SwissProt Collaboration entre SIB (Swiss Institute of Bioinformatics ) et EBISwiss Institute of Bioinformatics Fin 2003 : création de UniProt (Universal Protein Resource) Mise en commun des informations de PIR et SwissProt/TrEMBL « entrepôt » central de séquences et fonctions protéiques

37 PIR, ses deux bases de données PSD : Protein Sequence Database Séquences protéiques avec annotation fonctionnelle «the most comprehensive and expertly annotated protein sequence database in the public domain » PIR-NREF : Non redondant protein sequences Pas plus dune entrée pour une protéine (comparaison de toutes les séquences entre elles) Données : PIR-PSD, SwissProt, TrEMBL, RefSeq, GenPept, PDB

38 SwissProt, ses deux banques SwissProt Données corrigées et validées par des experts Haut niveau dannotation Description de la fonction (références associées) Localisation des domaines fonctionnels Modifications post-traductionnelles Existence de variants, … Redondance minimale Nombreux liens vers dautres banques (60 BD) TrEMBL Entrées supplémentaires à SwissProt (pas encore annotées) Traduction automatique de lEMBL

39 SwissProt/TrEMBL, croissance

40 SwissProt/TrEMBL, format dune entrée Format basé sur celui de lEMBL Mot-clé de 2 lettres au début de chaque ligne Les mêmes mots-clés sont utilisés Format différent pour les Features Mots-clés supplémentaires : GN : les différents noms du gène qui code pour la protéine (OR) les différents gènes qui codent pour la même protéine (AND) OX : références croisées vers les banques taxonomiques CC : commentaires, lignes très documentées dans SwissProt KW : mots-clés issus dun distionnaire

41 SwissProt/TrEMBL, lignes CC Informations découpées en blocs pour plus de lisibilité CC -!- TOPIC: First line of a comment block; CC second and subsequent lines of a comment block. De nombreux sujets sont abordés FUNCTION : description générale de la fonction de la protéine CATALYTIC ACTIVITY : description des réactions catalysées par les enzymes DEVELOPMENTAL STAGE : description du stade spécifique auquel la protéine est exprimée SUBUNIT : complexes dont fait partie la protéine (+ partenaires) …

42 SwissProt/TrEMBL, lignes FT Régions ou sites dintérêt dans la séquence Modifications post-traductionnelles Sites de fixation Sites actifs denzymes Structures secondaire Changements de séquence (y compris les variants) Format en colonne (nb caractères) 1-2 : FT 6-13 : Key (mot-clé, vocabulaire contrôlé) : début et fin de lobjet : description (éventuellement sur plusieurs lignes)

43 UniProt, les différentes banques UniProt : UniProt Knowledgebase Deux parties : entrées annotées manuellement (SwissProt) et entrées annotées de façon automatique (TrEMBL) Plus dinformations que dans les banques dorigine UniRef : UniProt Non-redundant Reference database UniRef100 : regroupement des séquences identiques et de leurs fragments provenant dun même organisme UniRef90 : entrées de UniRef100 avec plus de 90% didentité UniRef50 : idem pour 50% didentitié UniParc : UniProt Archive UniProt + dautres banques (PDB, RefSeq, FlyBase, brevets, …)

44 Banques protéiques, dernières versions PIR-PSD : n° 80, 31/12/05, entrées PIR-NREF : n° 1.77, 19/09/05, entrées. PIR ( entrées) GenPept ( entrées) RefSeq : entrées PDB : entrées SwissProt : n° 48, 13/09/05, entrées TrEMBL : n° 31, 13/09/05: entrées UniProt : n° 6.0, 13/09/05: entrées UniRef100 : , UniRef90 : , UniRef50 : UniParc :

45 Une Banque bibliographique, PubMed Contient Journaux concernant la biologie et la médecine Articles indexés par des experts à laide des termes MeSH Termes MeSH : vocabulaire contrôlé de termes biomédicaux et de molécules chimiques Hiérarchisé Dictionnaire de synonymes termes médicaux, termes chimiques Subheadings : sous-titres qui décrivent un aspect particulier des termes MeSH Mis à jour régulièrement

46 Exemple de terme MeSH

47 Systèmes dinterrogation de banques de données

48 Interrogation dune banque But : Obtenir des informations nouvelles et pertinentes Aide à la mise au point dexpériences Validation des résultats dune expérience Contraintes pour un systèmes dinterrogation Obtention de données pertinentes (pas trop de résultats, mais tous ceux relatifs à notre problématique) Simplicité dutilisation (syntaxe dinterrogation intuitive) Réponse rapide Possibilité danalyse des résultats (couplage à des outils)

49 Entrez, le système dinterrogation du NCBI Interface propriétaire (ne peut être installée par autrui) Opérateurs en majuscule AND, OR, NOT Nom du champ entre crochets homo sapiens [organism] Aide dans « Preview/Index » Historique (lien « History ») Ajout de limites (lien « Limits ») Sauvegarde, format Boutons « Display », « send to » Menus déroulants associés

50 Entrez, liens entre banques et entrées PubMed OMIM Genome Nucleotide Protein Structure Taxonomy Similarité (BLAST) termes MeSH communs Liens entre banques Accès aux liens entre banques à laide du menu associé au bouton « Display »

51 SRS, le système dinterrogation de lEBI (TIGR) Système libre, de nombreux miroirs existent Onglet « Libary » Choix de la ou des banques interrogées Onglet « Query » Lancement du formulaire Onglet « Results » Historique des requêtes Onglet « Views » Création de format daffichage

52 Interrogation via SRS Opérateurs & (et), | (ou), ! (non) Nom des champ dans des menus déroulants Sauvegarde, format Bouton « Save » Bouton « Rerun query » Options associées Analyse bioinformatique des entrées Bouton « Launch »

53 SRS, le découpage en sous-entrées Sous-entrée : partie extraite dune entrée Annotation et séquence associée (fragment séquence parent) Utile dans le cas de champs répétés dans une entrée EMBL : références, « features », compteurs UniProt : ref, commentaires, liens, « features », compteurs Interrogeables facilement via le formulaire étendu Liste de valeurs quand vocabulaire contrôlé Sous-entrées « compteurs » Nombre dapparitions de certains champs dans les entrées Non disponible dans Entrez

54 SRS, liens entre banques Construits à partir des informations présentent dans les entrées Les liens sont bidirectionnels Les liens sont propagés : A lié à B et B lié à C alors A lié à C Deux types de liens Dans une entrée sous la forme dhyperliens (HTML) Par requête à laide du bouton « Link », à partir dune liste dentrées. Pas de liens entre entrées dune même banque

55 Quelques formats de données biologiques Format des banques, exemples : Séquences ADN/ARN : EMBL ; GenBank et DDBJ Séquences protéiques : SwissProt et TrEMBL ; PIR ; … Formats lus par la plupart des outils en bioinformatique FASTA Séquence brute (« raw sequence ») Conversion de formats Lors de la consultation des banques Le programme ReadSeq (nimporte quel format en entrée, choix du format de sortie)

56 Le format FASTA ( et Multi-FASTA) Une ligne de commentaires précédé de « > » La séquence brute (pas despace, ni de nombre) >Human Polycomb 2 homolog (hPc2) mRNA, partial cds ctccggcagcccgaggtcatcctgctagactcagacctggatgaacccat agacttgcgctcggtcaagagccgcagcgaggccggggagccgcccagct ccctccaggtgaagcccgagacaccggcgtcggcggcggtggcggtggcg gcggcagcggcacccaccacgacggcggagaagcctccagccgaggccca ggacgaacctgcagagtcgctgagcgagttcaagcccttctttgggaata taattatcaccgacgtcaccgcgaactgcctcaccgttactttcaaggag tacgtgacggtg


Télécharger ppt "Quelques mots sur la bioinfo Maude Pupin. Déroulement des 6 séances de TP : 5 séances de TP + un examen de TP sur l'ensemble. Banques de données (aujourd'hui)"

Présentations similaires


Annonces Google