La présentation est en train de télécharger. S'il vous plaît, attendez

La présentation est en train de télécharger. S'il vous plaît, attendez

Hypermutabilité et adaptation chez les souches de Staphylococcus aureus isolées de mucoviscidose : rôle des gènes mutS et mutL et impact sur la résistance.

Présentations similaires


Présentation au sujet: "Hypermutabilité et adaptation chez les souches de Staphylococcus aureus isolées de mucoviscidose : rôle des gènes mutS et mutL et impact sur la résistance."— Transcription de la présentation:

1 Hypermutabilité et adaptation chez les souches de Staphylococcus aureus isolées de mucoviscidose : rôle des gènes mutS et mutL et impact sur la résistance aux macrolides Anne-Laure PRUNIER Directeur de thèse : Pr. R. Leclercq Laboratoire Relations hôte et microorganismes des épithéliums, EA 2128 Faculté de médecine, Université de Caen Basse- Normandie

2 2 Hypermutabilité et adaptation bactériennes

3 3 Survie des bactéries dans lenvironnement : transmission fidèle du matériel génétique Adaptation des bactéries à un environnement fluctuant : modification du matériel génétique Existence dune petite proportion de bactéries hypermutables au sein des populations

4 4 Bactéries non mutatrices avec mutations favorables Hypermutabilité et évolution Bactéries non mutatrices avec mutations délétères Bactéries mutatrices avec mutations délétères Bactéries mutatrices avec mutations favorables Chemin direct (lent) Chemin indirect (rapide) : Mutateur transitoire Bactéries mutatrices Bactéries non mutatrices Pression de sélection Taddei et al., Science, 1997

5 5 Deux mécanismes principaux de modification du matériel génétique : Partiellement contrôlés par le système de réparation des mésappariements (SRM) Acquisition de matériel génétique étranger (transfert horizontal puis recombinaison homéologue) Acquisition de mutations et transmission à la descendance (transfert vertical)

6 6 Le SRM chez E. coli Marti, T.M. et al., J. Cell. Physiol., 2002

7 7 Conservation de la protéine MutS S.aureus 347 ISVKDGGLFKVGFNTQLDEYLEASKNGKTWLAELQAKERQRTGIKSLKISFNKVFGYFIE B.subtilis 350 LSVKEGNLIKDGYNQKLDEYRDASRNGKDWIARLEQQEREYTGIRSLKVGFNKVFGYYIE E.coli 357 VLVRDGGVIASGYNEELDEWRALADGATDYLERLEVRERERTGLDTLKVGFNAVHGYYIQ P.aeruginosa 359 AVIRDGGVIKTGYDAELDELQALSENAGQFLMDLEAREKARTGLPNLKVGYNRIHGYFIE S.aureus 407 ITRANLQNFEPSEFGYMRKQTLSNAERFITDELKEKEDIILGAEDKAIELEYQLFVQLRE B.subtilis 410 VTKANLHLLE--EGRYERNETLTNAERYITPELKEKEALILEAENNICELEYELFTELRE E.coli 417 ISRGQSHLAP---INYMRRQTLKNAERYIIPELKEYEDKVLTSKGKALALEKQLYEELFD P.aeruginosa 419 LPRVQAEQAP---ADYIRRQTLKGAERFITPELKAFEDKALSAQSRALAREKALYEELLE S.aureus 467 EVKKYTERLQQQAKIISELDCLQSFAEIAQKYNYTRPSFSENKTLELVESRHPVVERVMD B.subtilis 468 KVKQYIPRLQQLAKQMSELDALQCFATISENRHYTKPEFSKD-EVEVIEGRHPVVEKVMD E.coli 474 LLLPHLEALQQSASALAELDVLVNLAERAYTLNYTCPTFIDKPGIRITEGRHPVVEQVLN P.aeruginosa 476 RLIGHLAPLQDSASALAELDVLANLAERALNLDLNRPRFVEHTCLHIEQGRHPVVEQVLE S.aureus 527 YNDYVPNNCRLDNETFIYLITGPNMSGKSTYMRQVAIISIMAQMGAYVPCKEAVLPIFDQ B.subtilis 527 SQEYVPNNCMMGDNRQMLLITGPNMSGKSTYMRQIALISIMAQIGCFVPAKKAVLPIFDQ E.coli 534 EP-FIANPLNLSPQRRMLIITGPNMGGKSTYMRQTALIALMAYIGSYVPAQKVEIGPIDR P.aeruginosa 536 TP-FVANDLALDADTRMLVITGPNMGGKSTYMRQTALIVLLAHIGSFVPAARCELSLVDR S.aureus 587 IFTRIGAADDLVSGKSTFMVEMLEAQKALTYATEDSLIIFDEIGRGTSTYDGLALAQAMI B.subtilis 587 IFTRIGAADDLISGQSTFMVEMLEAKNAIVNATKNSLILFDEIGRGTSTYDGMALAQAII E.coli 593 IFTRVGAADDLASGRSTFMVEMTETANILHNATEYSLVLMDEIGRGTSTYDGLSLAWACA P.aeruginosa 595 IFTRIGSSDDLAGGRSTFMVEMSETANILHNATDKSLVLMDEVGRGTSTFDGLSLAWAAA

8 8 Conservation de la protéine MutL

9 9 SRM et recombinaison Inhibe la recombinaison entre fragments dADN homéologues : barrière à léchange interspécifique (Matic et al., Trends Microbiol., 1996) Important pour la notion de mutateur transitoire : réacquisition facilitée dun SRM fonctionnel par recombinaison (de Visser, Microbiology, 2002) Confirmé par la structure en mosaïque des gènes mutS et mutL (Denamur et al., Cell, 2000)

10 10 Hypermutabilité et pathogénicité Données contradictoires sur cette relation Avantage dans certaines pathologies, dans certaines conditions Ex : forte pression antibiotique environnement hostile et fluctuant Altérations du SRM dans de nombreux cas

11 11 Hypermutabilité et résistance aux antibiotiques Mutateurs = facteurs de risque : résistance par mutation mutations compensatoires du coût biologique de la résistance Antibiotiques = sélecteurs de lhypermutabilité (Blazquez, Clin. Infect. Dis, 2003) Sélection de clones résistants Antibiotique A Antibiotique B Sélection de clones résistants

12 12 Hypermutabilité et mucoviscidose

13 13 La mucoviscidose Maladie génétique due à une mutation du gène cftr : atteintes pulmonaires et digestives (circulation difficile du chlore à travers la membrane cellulaire) Atteinte pulmonaire : mucus épais contribuant à linflammation et à linfection, principale cause de décès

14 14 Infections bactériennes chez les malades Espèces bactériennes impliquées : H. influenzae (patients jeunes) S. aureus (patients jeunes) P. aeruginosa (patients plus âgés) Adaptation pour combattre la réponse inflammatoire de lhôte : P. aeruginosa dits « mucoïdes » small colony variants de S. aureus Administration prolongée de multiples antibiotiques

15 15 Hypermutabilité des souches isolées de mucoviscidose P. aeruginosa : 19,5% de souches hypermutables, phénotype surtout dû à des altérations du SRM (Oliver et al., Science, 2000) H. influenzae : 14,5% de souches hypermutables (Roman et al., J. Clin. Microbiol., 2004)

16 16 Les macrolides

17 17 Surtout actifs sur les bactéries à Gram positif Inhibent la synthèse protéique : fixation à la sous unité 50S du ribosome (centre peptidyl transférase)

18 18 Résistance par mutation (1) L4 L22 NISSEN et al., Science, 2000

19 19 Particulièrement aux positions A2058 et A2059 Mutations de lARNr 23S (gène rrl) : faible nombre de copies du gène mycobactéries (1 copie) H. pylori (2 copies) S. pneumoniae (4 copies) Jamais décrites chez S. aureus : 5/6 copies Résistance par mutation (2)

20 20 S. aureus Macrolide Ribosome Résistance aux macrolides chez S. aureus Gènes de résistance acquis : Méthylase CH 3 (1) erm (2) ABC transporteur msr(A) Modification enzymatique (3)

21 21 Résultats

22 22 Point de départ de létude Observation au CHU de Caen : augmentation importante de la proportion de S. aureus résistants aux macrolides isolés de mucoviscidose ( 50% en 1999) Corrélation avec laugmentation de lutilisation de lazithromycine pour son effet indirect putatif sur P. aeruginosa (anti-adhésion et réduisant linflammation) ?

23 23 Analyse des mécanismes de résistance aux macrolides chez les S. aureus isolés de mucoviscidose

24 24 Mutations de la cible des macrolides Patient (Souches) Gènes de résistance ARNr 23S L4L22 Domaine VDomaine II 1A 1B 1C, 1D A2058T A2059G A2058G B 2C erm - A2058G A 3C 3D erm A, 4Bmsr(A)T2089C, C2207T--- 5B 5C, 5D, 5E erm - C2163T A2058G, C2207T B 6C ---- A2058G + 3 A2058G A2059G--- 9-A2058G--- (4/5) (3/5) (4/6)

25 25 Mutation du gène rrl Mutation successivement dans chaque copie X 1 X 2 X 3 X 4 X 5 X 6 X XXXXX Mutation dune copie puis transmission aux autres par conversion génique

26 26 Analyse du gène rrl quand 2 mutations adjacentes sont détectées Souche Mutations Copie ACopie BCopie CCopie DCopie ECopie F 4A 2089C, 2207T wt2089C, 2207Twt2089C, 2207Twt 5C 2058G, 2207T 5D 2058G, 2207T wt2058G, 2207Twt2058G, 2207T 5E 2058G, 2207T wt2058G, 2207T Les mutations semblent sêtre répandues par conversion génique entre les copies du gène rrl : recombinaison facilitée ?

27 27 Mutations des gènes domestiques Détection daltérations de gènes domestiques chez les souches accumulant de nombreuses mutations ribosomales : sodA : résistance au stress oxydatif spa : adhésion

28 28 Recherche de souches hypermutables parmi des isolats cliniques de S. aureus

29 29 Proportion de souches hypermutables chez les S. aureus isolés ou non de mucoviscidose Test de Fisher (qualitatif): différence significative (p=0,0045) Test de Mann-Whitney (quantitatif): différence significative (p=0,05) Confirmé sur streptomycine 13 / 89: fréquence de mutation sur rifampicine > / 74: fréquence de mutation sur rifampicine > Les souches résistantes aux macrolides isolées de mucoviscidose accumulant de nombreuses mutations (ribosome + gènes domestiques) nétaient pas hypermutables !

30 30 Analyse moléculaire de mutS et mutL chez les S. aureus cliniques Gènes très conservés chez S. aureus 10 paires damorces définies Séquençage intégral de la région mutSL chez les mutateurs et chez 4 souches contenant de nombreuses mutations ribosomales

31 31 Mutations de la cible des macrolides Patient (Souches) Gènes de résistance ARNr 23S L4L22 Domaine VDomaine II 1A 1B 1C, 1D A2058T A2059G A2058G B 2C erm - A2058G A 3C 3D erm A 4B msr(A) T2089C, C2207T B 5C, 5D, 5E erm - C2163T A2058G, C2207T B 6C ---- A2058G + 3 A2058G A2059G--- 9-A2058G---

32 32 Souches 3A et 5B Pas damplification avec les amorces mutSL Le gène mutS est indétectable en Southern blot : A B C S 3A 5B S 3A 5B S 3A 5B S: souche de référence S. aureus RN4220 Électrophorèse sur gel dagarose de lADN total restreint Hybridation avec une sonde rrl (contrôle positif) Hybridation avec une sonde mutS Etape ultime de lévolution des S. aureus isolés de mucoviscidose? Etape ultime de lévolution des S. aureus isolés de mucoviscidose?

33 33 Altérations des protéines MutS et MutL SoucheHypermutabilitéMutSMutL 1A + délétion F488 à R528, T192Aaucune UCN22 + délétion 5060 pb (1900 pb mutS et tout mutL) UCN23 + aucune UCN24 + aucune UCN25 + aucune UCN26 + aucune UCN27 + aucunedel L275 à R279 UCN28 + aucuneY314H UCN29 + N181H, N373D, T415M, N588D, L811S, S814C N364D, S377R, N418D UCN30 + aucune UCN31 + aucune 3A - délétion 3C - N181H, S201P, N373D, T415M, V773G, G789D, L811S ND 4A - aucuneND 5B - délétion

34 34 Analyse des gènes mutS et mutL chez S. aureus

35 35 Le SRM des bactéries à Gram positif Surtout étudié chez B. subtilis, L. monocytogenes, S. pneumoniae Corégulation des gènes mutS et mutL : opéron (B. subtilis, L. monocytogenes) séquences régulatrices similaires en amont (S. pneumoniae)

36 36 pBT1 (6.73kb) Analyse in silico de la région mutSL chez S. aureus U1S L4S (1993 pb) (8723 pb) U5SL1L (1211 pb) U5L glpL (717 pb) U1L L4L (1785 pb) ? ΔG=-17.3 kJ/mol? ΔG=-22.4 kJ/mol 302 pb 12 pb 14 pb36 pb 348 pb glpF SA1136 mutS (2619 pb)mutL (2010 pb) glpP HP

37 37 Analyse par RT-PCR de la région mutSL 500 pb 1000 pb 1500 pb 2000 pb T 42 S 42 S 42 S 42 S glpF SA1136 mutS (2619 pb) mutL (2010 pb) glpP HP (1993 pb) (+pBT1 = 8723 pb) (1211 pb) (717 pb) (1785 pb)

38 38 Rôle de MutS dans lhypermutabilité chez S. aureus pORI23 pORI23 mutS pORI23 mutS1A pORI23 mutS29 RN pORI23mutS mutS + pORI23mutS RN pORI23mutS1A mutS + pORI23mutS1A mutS + pORI23mutS29 RN pORI23mutS29 mutS + pORI23 RN pORI23

39 39 Rôle de MutS dans lhypermutabilité chez S. aureus pORI pORI23 mutS29 mutS mutS + pORI23 mutS + pORI23 mutS mutS + pORI23 mutS1A mutS + pORI23 mutS29 Log inverse des fréquences de mutation pORI23 mutS pORI23 mutS1A

40 40 3 Log inverse des fréquences de mutation pAT mutL pAT pAT mutL pAT mutL29 mutL mutL + pAT392 mutL+ pAT mutL mutL + pAT mutL27 mutL + pAT mutL29 Rôle de MutL dans lhypermutabilité chez S. aureus

41 41 Rôle de MutS et MutL dans la prévention de la recombinaison homéologue chez S. aureus (1) pBT1 (TS, CHL R ) pBT1sodA (100%) pBT1sodA (97%) pBT1sodA (94%) pBT1sodA (87,5%) pBT1sodA (74%) pBT1sodA (82,3%) RN4220 mutS mutL 3 cultures successives à 42°C + CHL

42 S. aureus RN4220 Pourcentage didentité avec sodA y=4.45x10 -2 X R²= Survie après 3 cultures successives à 42°C (ratio de linoculum initial) Rôle de mutS et mutL dans la prévention de la recombinaison homéologue chez S. aureus (2) S. aureus mutL DNA sequence identity y=4.72x10 -2 X R²= Survie après 3 cultures successives à 42°C (ratio de linoculum initial) Pourcentage didentité avec sodA DNA sequence identity y=4.18x10 -2 X R²= S. aureus mutS Survie après 3 cultures successives à 42°C (ratio de linoculum initial) Pourcentage didentité avec sodA

43 43 Relation entre hypermutabilité et résistance aux macrolides chez les S. aureus isolés de mucoviscidose

44 44 77 % chez les S. aureus hypermutables 50 % chez les S. aureus non hypermutables Les souches hypermutables sont plus fréquemment résistantes (p<0,05 Test de Fisher) Résistance à lérythromycine

45 45 Sélection de clones résistants Erythromycine Azithromycine Télithromycine Souches hypermutables Souches témoins Log inverse des fréquences de mutation

46 46 Conclusions (1) Mucoviscidose : résistance aux macrolides des S. aureus surtout due à des mutations de la cible ribosomale Au moins trois copies du gène rrl étaient mutées chez chaque mutant de lARNr 23S étudié La dissémination dune mutation rrl entre les différentes copies du gène semble se faire par conversion génique Relation avec ladministration prolongée dazithromycine aux patients atteints de mucoviscidose (?)

47 47 Conclusions (2) Ces observations pourraient être liées à une forte proportion de souches hypermutables chez les S. aureus dans la mucoviscidose: Les souches hypermutables sont plus fréquemment résistantes à lérythromycine Les souches hypermutables sensibles aux macrolides acquièrent plus facilement une résistance par rapport aux souches sauvages Lutilisation de combinaisons dantibiotiques semble nécessaire pour éviter lapparition de souches hypermutables

48 48 Conclusions (3) Spécificité de lhypermutabilité des souches isolées de mucoviscidose ? Non : forte proportion de mutateurs dans dautres pathologies (ex: ITU – Denamur et al., J. Bacteriol., 2002 ) Effets conjugués des pressions (antibiotiques + réponse immunitaire de lhôte) : sélection de mutateurs

49 49 Conclusions (4) Rôle de MutS et MutL chez S. aureus : Hypermutabilité : confirmé chez 4 souches cliniques Recombinaison : effet limité ? Perspectives : Autres gènes mutateurs chez S. aureus ? Relation entre hypermutabilité et évolution du génome de S. aureus ?

50 Hypermutabilité et adaptation chez les souches de Staphylococcus aureus isolées de mucoviscidose : rôle des gènes mutS et mutL et impact sur la résistance aux macrolides Anne-Laure PRUNIER Directeur de thèse : Pr. R. Leclercq Laboratoire Relations hôte et microorganismes des épithéliums, EA 2128 Faculté de médecine, Université de Caen Basse-Normandie


Télécharger ppt "Hypermutabilité et adaptation chez les souches de Staphylococcus aureus isolées de mucoviscidose : rôle des gènes mutS et mutL et impact sur la résistance."

Présentations similaires


Annonces Google