La présentation est en train de télécharger. S'il vous plaît, attendez

La présentation est en train de télécharger. S'il vous plaît, attendez

Analyse statistique des séquences génomiques DEA en bioinformatique Lausanne, 3 mai 2001 Laurent Duret

Présentations similaires


Présentation au sujet: "Analyse statistique des séquences génomiques DEA en bioinformatique Lausanne, 3 mai 2001 Laurent Duret"— Transcription de la présentation:

1 Analyse statistique des séquences génomiques DEA en bioinformatique Lausanne, 3 mai 2001 Laurent Duret

2 Plan Taille des génomes, paradoxe de la valeur C Contenu informationnel Séquences répétées Organisation en isochore des génomes de vertébrés Prédiction de gène protéiques Prédiction de régions régulatrices non-codantes Usage des codons synonymes

3

4

5

6

7 How many genes in the human genome ?

8 Functional elements in the human genome Untranslated RNAs: Xist, H19, His-1, bic, etc. Regulatory elements: promoters, enhancers, etc. Repeated sequences (SINES, LINES, HERV, etc.) : 40% of the human genome

9 Structure of human protein genes 1396 complete human genes (exons + introns) from GenBank (1999) Average size (25%, 75%) –Gene15 kb ± 23 kb (4, 16) (10% > 35 kb) –CDS1300 nt ± 1200 (600, 1500) –Exon (coding) 200 nt ± 180 (110, 200) –Intron1800 nt ± 3000 (500, 2000) –5'UTR210 nt (Pesole et al. 1999) –3'UTR740 nt (Pesole et al. 1999) Intron/exon –Number of introns:6 ±3 introns / kb CDS –Introns / (introns + CDS):80% –5' introns in 15% of genes (more ?), 3 introns very rare Alternative splicing in more than 30% of human genes (Hanke et al. 1999)

10 Structure of human protein genes GenBank: bias towards short genes 2408 complete human genes (exons + introns)

11 Structure of human protein genes GenBank: bias towards short genes 1396 complete human genes (exons + introns) 9268 complete human mRNA

12

13

14 ADN satellite: centromères

15

16

17

18 Retropseudogènes 23,000 à 33,000 retropseudogènes dans le génome humain Les gènes qui génèrent des retropseudogènes sont généralement de type housekeeping Gonçalves et al. 2000

19 Fréquence des éléments transposables dans le génome humain Total = 42% (Smit 1999)

20 Fréquence des éléments transposables dans le génome humain (Smit 1999)

21 Isochore organization of vertebrate genomes

22 Organisation en isochore des génomes de vertébrés: mise en évidence expérimentale Fractionnement du génome de la souris par centrifugation en gradient de densité (Bernardi et al. 1976)

23 Analyse statistique des séquences publiées dans les banques de données. Corrélation entre la composition en base en position 3 des codons et celle de l'envirronement génomique dans lequel se trouve le gène

24 Analyse statistique des séquences publiées dans les banques de données. Distribution en fréquence des gènes dans les différentes classes d'isochores CDS GC3% HommePoulet Nb de gènes (%) Moy =.509 Ecart-t = séq Xénope Danio Moy =.580 Ecart-t = séq

25 Evolution de la structure en isochore chez les vertébrés

26 Isochore organization of vertebrate genomes Insertion of repeated sequences (A. Smit 1996) Recombination frequency (Eyre-Walker 1993) Chromosome banding (Saccone, 1993) Replication timing (Bernardi, 1998) Gene density (Mouchiroud, 1991) Gene expression ?? -> No Gene structure (Duret, 1995)

27 Isochores and insertion of repeat sequences (Smit 1999) 4419 human genomic sequences > 50 kb

28 Isochores and gene density MHC locus (3.6 Mb) (The MHC sequencing consortium 1999) Class I, class II (H1-H2 isochores): 20 genes/Mb, many pseudogenes Class III (H3 isochore): 84 genes/Mb, no pseudogene Class II boundaries correlate with switching of replication timing

29 Isochores and introns length 760 complete human genes L1L2: intron G+C content < 46% H1H2: intron G+C content 46-54% H3: intron G+C content >54% Duret, Mouchiroud and Gautier, 1995

30 Next steps in genome projects Identify genes and other functional elements within genomic sequence (where are the genes ?) Determine the function of genes (what do they do ?)

31 Prédiction ab initio de gènes eucaryotes Introns, exons Prédiction de gènes protéiques –Recherche de phases ouvertes de lecture (ORF: open reading frame) Phase +0 Phase +1 Phase +2 ATGTACCGTCGATCGTAGCTTGATCGATCG TACATGGCAGCTAGCATCGAACTAGCTAGC Phase -0 Phase -1 Phase -2 Taille moyenne des ORF: ± 150 nt –Statistiques sur les nucléotides, usage des codons Hexamères –Signaux d épissage

32 Prédiction de gènes eucaryotes (suite) Construction d un modèle de gène protéique –Combinaison d exons de phases compatibles (pondération en fonction des scores de chaque exon potentiel) –Recherche de limites de gènes Exons terminaux (5, 3 ) Promoteur Signal de polyadénylation

33 Prédiction de gènes eucaryotes: qualité de la prédiction Comparaison des différents logiciels: sensibilité/spécificité –Sensibilité : fraction des exons présents dans la séquence qui sont bien retrouvés –Spécificité : fraction des vrais exons parmi tous ceux qui sont prédits –Sn: sensibilité Sp: spécificité par exon (sn_e, sp_e) ou par nucéotide (sn_e, sp_e) –Jeu de données Burset-Guigo (1996): 570 gènes de vertébrés

34 Prédiction de gènes eucaryotes: qualité de la prédiction Comparaison des différents logiciels: sensibilité/spécificité –Sn: sensibilité Sp: spécificité par exon (sn_e, sp_e) ou par nucéotide (sn_e, sp_e) –Locus BRCA2 (1.4 Mb, chrom. 13q) (Sanger Centre 1999): région "difficile" pour les logiciels de prédiction. 159 exons

35 Prédiction de gènes protéiques complets C. elegans: la plupart des gènes annotés sont seulement des prédictions Peut-on utiliser ces méthodes pour annoter les séquences génomique humaines ? –+ les faux positifs !+ épissage alternatif ! –exons non-codants !

36 Un peu d optimisme Fraction de la longueur des gènes correctement prédits: 70-80% Probabilité que deux exons potentiels consécutifs soient réels (et donc positifs en RT-PCR) 0.5

37 Prediction of functional elements (2) Large scale transcriptome projects: ESTs, full-length cDNA Identification of transcribed genes (protein or non-coding RNA) Information on alternative splicing, polyadenylation (Hanke et al. 1999, Gautheret et al. 1998), expression pattern SIM4: align a cDNA to genomic DNA Very useful but... Problems with genes expressed at low level, narrow tissue distribution, stage-specific expression, … Limited tissue sampling Artifacts in ESTs (introns, partially matured RNA, …) Limited to polyadenylated RNA

38 Prediction of functional elements (3) Comparative sequence analysis (phylogenetic footprinting) Function => selective pressure Corollary Sequence conservation = selective pressure = function provided the number of aligned homologous sequences represents enough evolutionary time for the accumulation of mutations at the less constrained (presumably selectively neutral) base positions. Evolutionary rate in non-functional DNA: ~ 0.3% / My (± 0.069) Man/Mouse: ~ 80 Myrs46-58% identity Mammals/Birds: ~ 300 Myr26-28% identity Random sequences25% identity

39 Analyse comparative des gènes de -actine de l'homme et de la carpe

40

41

42 Approche comparative (suite) Comparaison d une séquence génomique avec des gènes déjà caractérisés dans d autres espèces (WISE2: alignement ADN/protéine avec épissage) Comparaison de séquences génomiques (non-annotées) homologues –Locus mnd2 (homme souris) (Jang et al. 1999): >80 kb –Prédiction d exons internes basée sur la conservation de séquence ORF 80 nt Séquence protéique 70% similarité Séquence ADN 50% identité GT AG conservés => détection de tous les exons internes du gène D6Mm5e Généralisation de la méthode : Sensibilité ? Spécificité ?

43 Approche comparative: quelle est la bonne distance ? Guigo, Duret, Wiehe Homme/drosophile (670 Ma) Homme/fugu (450 Ma) Homme/poulet (300 Ma) Homme/souris ( Ma) Rat/souris (15 Ma) 8 Sp_nSn_ndistance N Recherche dexons codants conservés entre séquences génomiques orthologues (TBLASTX)

44 Phylogenetic footprinting Advantages Works for all kinds of functional elements (transcribed or not, coding or not) as far as the information is in the primary sequence Does not require any a priori knowledge of the functional elements Limits Absence of evolutionary conservation does not mean absence of function No efficient method to detect unknown conserved secondary structure in RNA Function, but what function ? Number of sequences to compare : > 200 Myrs of evolution Mammals/birds: 310 Myrs Human + mouse + bovine : 240 Myrs

45 Annotation systématique du génome humain ENSEMBL project –http://www.ensembl.org/ Human Genome Project Working Draft at UCSC –http://genome.ucsc.edu/ The genome channel –http://compbio.ornl.gov/channel/index.html

46 Prédiction de régions régulatrices Méthodes ab initio –Prédiction de promoteurs –Îlots CpG Approche comparative

47 Prédiction de promoteurs eucaryotes Combinaison de sites de fixation de facteur de transcription (ordre, orientation, distance) Motifs courts, dégénérés –Difficile de distinguer les vrais sites des faux positifs: –Motif à 4 bases: 1/256 pb (1/128 pb sur les deux brins) Boîtes TATA, CAAT, GC: absents dans beaucoup de promoteurs Banques de données de sites de fixation de facteurs de transcription (TRANSFAC), de promoteurs caractérisés expérimentalement (EPD) PromoterScan (Prestridge 1995) : Mesure de la densité en sites potentiels de fixation de facteurs de transcription de long de la séquence (pondération en fonction de la fréquence des sites dans ou en dehors des vrais promoteurs)

48 Prédiction de promoteurs: sensibilité, spécificité Sensibilité: fraction des promoteurs qui sont trouvés par le logiciel –PromoterScan: sensibilité = 70% (promoteurs à boîte TATA) Spécificité: fraction des vrais promoteurs parmi ceux qui ont été prédits –PromoterScan: spécificité = 20% –Un faux positif / 10 kb Génome humain: gènes, 1 promoteur/30 kb

49 Prédiction de promoteurs eucaryotes: recherches en cours Prise en compte de l'orientation relative et des distances entre sites de fixation de facteurs de transcription –COMPEL (Kolchanov 1998) : banque de données d'éléments composites –FastM : recherche dans une séquence génomique d'une combinaison de deux sites de fixation de facteurs de transcription à une distance définie l'un de l'autre Recherche de corrélations entre sites –PromoterInspector (Werner 2000) Sensibilité: 40% Spécificité: 45% Combinaison recherche ab initio / approche comparative: recherche de sites potentiels parmi les régions conservées

50 Îlots CpG Génome de vertébrés : –méthylation des C dans les dinucléotides 5 -CG-3 (CpG) Me-C fortement mutable -> T 5 -CG TG-3 5 -CA-3 3 -GC AC-5 3 -GT-5 Génome des vertébrés: globalement dépourvu en CpG (excès de TG, CA) Certaines régions (200 nt à plusieurs kb) échappent à la méthylation –Pas de déplétion en CpG: CpG o/e proche de 1 –Riche en G+C –Îlot CpG: Longueur > 500 nt CpGo/e > 0.6 G+C > 50% ou

51 La déamination des cytosines Cytosine N C CH C N H NH 2 O CH réparation Cytosine N C CH C N H NH 2 O CH Cytosine méthylée N C CH C N H NH 2 O CH CH 3 Uracile HN C CH C N H O O déamination Thymine HN C CH C N H O O CH 3 déamination TpG ou CpA

52 Îlots CpG: associé aux régions promotrices ? Bird (1986), Gardiner-Garden (1987) Larsen (1992) ref –40% des gènes tissu-spécifiques possèdent un îlot CpG en 5 –100% des gènes housekeeping possèdent un îlot CpG en 5 Rechercher des îlots CpG pour prédire des régions promotrices ? –Sensibilité: % –Spécificité ?? (Quelle fraction des îlots CpG correspond effectivement à des régions promotrices ?) Ponger (2001): comparaison des îlot CpG qui recouvre ou non le site d initiation de la transcription

53 Fréquence des gènes humains avec un îlot CpG recouvrant le site d initiation de la transcription –800 gènes humains avec promoteur décrit –Mesure de la distribution tissulaire à l aide d EST (20 tissus)

54 Comparaison des îlots CpG recouvrant ou non le site d initiation de la transcription –272 îlots start CpG recouvrant le site d initiation de la transcription (start) –1078 îlots CpG en dehors d un promoteur connu (other) (en excluant les séquences répétées)

55 Recherche de régions régulatrices par analyse comparative (empreintes phylogénétiques) Goodman et al. 1988: régulation de lexpression des gènes du cluster - globine au cours du développement Alignement de séquences orthologues de 6 mammifères (> 270 Ma dévolution) 13 empreintes phylogénétiques: 6 nt, conservation 100% Analyse par retard de bande sur gel: 12/13 (92%) correspondent à des sites de fixation de protéines 1996: 35 empreintes phylogénétiques avec protéines fixatrices identifiées Enhancers de gènes HOX (Fugu/souris) (Aparicio et al. 1995) enhancer TCR (homme/souris) (Luo, 1998) promoteur COX5B (11 primates) (Bachman, 1996) promoteur uPAR (homme/souris) (Soravia, 1995)

56 Large scale phylogenetic footprinting Non-coding sequences : 325,247 sequences 145 Mb everything except protein-coding regions and structural RNA genes (rRNA, tRNA, snRNA, scRNA) Introns, 5' and 3' untranslated regions, intergenic sequences Filtering of microsatellite repeats and cloning vectors: XBLAST Similarity search: BLASTN + LFASTA Vertebrates, insects, nematode

57 Metazoan Genome Projects

58 Sequence Similarities 1- Identification of new genes protein-genes, RNA-genes: intronic snoRNA genes 2- Retroviral elements, retrotransposons 3- Low complexity sequences: GC-rich, AT-rich, cryptic microsatellites 4- Artefacts: annotation errors, sample contamination (sponge insulin, ascidian RNA, chicken TGFB1) highly conserved regions (HCRs) - do not code for proteins - do not correspond to any known structural RNA

59 326 Highly Conserved Regions (HCRs) > 70% identity over 50 to 2000 nt after more than 300 Myrs Unique sequences Generally specific of only one gene Longest HCR: 84% identity over 1930 nt after 300 Myrs 3UTR deltaEF1 transcription factor Oldest HCRs: 500 to 600 Myrs No HCR between vertebrates and insects or nematode

60 Oldest HCRs

61 Conservation pattern in 3UTRs

62 Distribution of HCRs within genes

63 HCRs and multigenic families

64 Function of 3HCRs: mRNA stability, translation

65 Function of 3HCRs: mRNA subcellular localization Myosin heavy chain, c-myc, vimentin, -actin

66 Comparaison des régions non-codantes de 77 gènes orthologues homme/souris (Jareborg et al. 1999) Fraction des régions non-codantes conservées entre homme et souris

67 Next steps in genome projects Identify genes and other functional elements within genomic sequence (where are the genes ?) Determine the function of genes (what do they do ?)

68 Prédiction de fonction par homologie ? Similarité entre séquences homologie Homologie structure conservée Structure conservée fonction conservée Oui, mais … –Fonction: concept flou activité biochimique identique ? e.g. même ligand pour un récepteur, même substrat pour une enzyme, même gènes cibles pour un facteur de transcription. distribution tissulaire ? (isoformes tissu-spécifiques). compartimentalisation cellulaire: cytoplasme, mitochondrie, etc. –Protéines homologues de fonction différentes Protéines homologues ligands (activateur/répresseur) d un même récepteur Recrutement pour une fonction totalement différente: -cristalline / -énolase –Orthologie/paralogie –Évolution modulaire

69 Prédiction de fonction par homologie ? MZEORFG: 1 ILNSPDRACNLAKQAFDEAISELDSLGEESYKDSTLIMQLLXDNLTLWTSDTNEDGGDE 59 I N+P++AC LAKQAFD+AI+ELD+L E+SYKDSTLIMQLL DNLTLWTSD ++ E BOV1433P: 186 IQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGE 244 Score = 87.4 bits (213), Expect = 1e-17 Identities = 41/59 (69%), Positives = 50/59 (84%) LOCUS BOV1433P 1696 bp mRNA MAM 26-APR-1993 DEFINITION Bovine brain-specific protein eta chain mRNA, complete cds. ACCESSION J03868 LOCUS MZEORFG 187 bp mRNA PLN 31-MAY-1994 DEFINITION Zea mays putative brain specific protein, tau protein homolog mRNA, partial cds.

70 Orthologie/paralogie

71 Approche phylogénétique pour la prédiction de fonction

72 Evolution modulaire

73

74

75

76

77

78

79

80

81

82

83

84

85

86

87

88

89

90


Télécharger ppt "Analyse statistique des séquences génomiques DEA en bioinformatique Lausanne, 3 mai 2001 Laurent Duret"

Présentations similaires


Annonces Google