Couplage électrophorèse capillaire- spectrométrie de masse (CE-MS) Formation CE-MS  : Couplage électrophorèse capillaire- spectrométrie de masse (CE-MS) Contact : Yannis FRANCOIS, Lab. de Spectrométrie de Masse des Interactions et des Systèmes 1 rue Blaise Pascal, 67000 Strasbourg email: yfrancois@unistra.fr

DETECTION LES PLUS COURANTS:  détection UV  détection par fluorescence  détection par spectrométrie de masse Détection OFF-COLONNE Détection ON-COLONNE + - + -

OFF-COLONNE  Détection par spectrométrie de masse  nécessite de concevoir une interface adaptée  assurer le maintien du champ électrique  diminuer les effets d’aspiration  utiliser des analyseurs permettant des scans rapides Interface basée sur le mode ESI/MS appliquée aux sels d’ammonium, amines, dipeptides ex : pour les ions simples, LOD = 10 amol

CE–MS Coupling Number of publications Web of scienceSM search using term “capillary electrophoresis and mass spectrometry”

Couplage CE-MS Advantages CE-MS Bonne efficacité Ultra-low flow rate Selectivité Sensibilité Information de structure Inconvénients CE-MS Faible volume d’échatillon (haute concentration) Compatibilité du BGE avec la MS Adsorption protéine surface interne Difficulté pour maintenir le courant

Les réponses aux limitations Adsorption des protéines à la surface interne du capillaire Greffage des parois internes du capillaire. Covalent (idéal pour MS) Dynamique (compatible MS) Exemple I Répétition d’analyse CE-UV d’une solution d’hormone de croissance (3mg/mL). Capillaire Viège Baisse de l’eof Baisse de la résolution Capillaire greffé PB-PVS RSD=0,68% (n=5) Tampon Tris-Phosphate 400 mM pH 8,5, 30 kV Catai et al. J. Chrom. B., 2006, 852, 160-166 6 6 6

Interface Sheath liquid CE-ESI-MS Interface à liquide additionnel « Sheath liquid » CE-MS la plus communément utilisée Initially developed by Richard D. Smith group (Olivares et al., Anal. Chem. 1987, 59, 1230-1232) Haselberg et al., LCGC North America 2012, 30 (6), 504-525 Significantly reduced sensitivity Sheath liquid induces analytes dilution (~ 4 µl/min)

Interface à liquide de jonction « junction liquid » Maxwell, E.J. et al. Analytica Chimica Acta, 2008. 627(1): p. 25-33. Zhong, X. et al. Analytical Chemistry, 2011. 83(12): p. 4916-4923. Réduction de la sensibilité Développement instrumentale Débit > 300 nL/min

Interface sans liquide additionnel « Sheathliquid » Augmentation de la sensibilité Modification du capillaire Débit < 100 nL/min

Interface CESI-MS CESI-MS allows to be operated using nano flowrates Favorable to ESI ionization CESI-MS showed improved sensitivity compared to sheath liquid interface Faserl et al., Anal. Chem. 2011, 83, 7297-7305 Busnel et al., Anal. Chem. 2010, 82, 9476-9483 Diagram and picture of the CESI interface

Optimisation du couplage CE-MS

CE-ESI-MS Coupling Advantages of CE-MS Great efficiency Ultra-low flow rate Selectivity Sensitivity Structural information

Les réponses aux limitations Jusqu’à présent, l’interface « sheathliquid » a été la plus utilisée

CE-ESI-MS Coupling “Ultra-low flow” CESI-MS CE is a miniaturized technique performing ultra-low flow rates Decreasing the flow allows for increased sensitivity in the ESI-MS1 “Ultra-low flow” CESI-MS 1Wilm, Mann International Journal of Mass Spectrometry 1994, 136, 167–180

Flow rates comparison Separation Technology Column Diameter Ultra-low flow ESI-MS Separation Technology Column Diameter Flow-rate (nL/min) High flow LC-MS 2.1 – 4.6 mm 200,000 – 2,000,000 Microbore LC-MS 1 mm 50,000-200,000 Microflow LC-MS 0.3-0.5 mm 2,000-50,000 CE-MS 50-100 µm 2,000 – 4,000 Nanoflow LC-MS 50-200 µm 100-1500 CESI-MS 30 µm < 30 CESI allows performing real nano flowrates

CESI Interface 30 µm ID separation capillary with outlet portion etched by HF, provides electrical contact Originally developed by M. Moini at U. of Texas and further developed by Beckman Coulter Inc.

What are the accessible flow rates?

CESI Interface Achievable Flow rates CESI-MS infusion of intact protein sample Conditions : Myoglobin 1 μM (in 10% acetic acid), Flow rates 3, 7 - 170 nL/min, Capillary voltage: -1400V, Investigated m/z : 848,94 Spray could be obtained using flow rate as low as 4 nL/min Gahoual et al, Analytical and Bioanalytical Chemistry 2014, 406 (4), 1029-1038

Influence of Flowrates on Sensitivity Evolution of the peak intensity of Angiotensin I (a) and detection sensitivity as a function of the flow rate (b) Experimental conditions: capillary electrophoresis; bare fused silica capillary with a porous tip, total length 88.5 cm×30 μmi.d.×150 μmo.d.; Infused sample, Angiotensin I at 2 ng/mL in 10% acetic acid. Mass spectrometry; capillary voltage,-1350 V; detection range, 50-3000m/z, Decreasing the flowrate from 350 to around 10 nL/min, sensitivity increased by a factor of 20 Busnel et al, Analytical Chemistry 2010, 82, 9476-9483

Decrease of the Ion Suppression Phenomenon at Very Low Flow Rates?

Importance of Flow Rates in ESI-MS: Ion Suppression Low Flow High Flow “Analyte suppression is practically absent at minimal flow rates below 20 nL/min” Schmidt, Karas, Dulcks , J Am Soc Mass Spectrom 2003, 14, 492–500

Infusion Pattern as a Function of Infusion Flow Rates Heemskerk et al, Analytical Chemistry 2012, 84, 4552-4559

Applications

Applications Chromatographie liquide Electrophorèse cIEF/MS CZE 2D Gel CEC cIEF/MS CGE Isoforme Charge Produit de dégradation non-utilisée Charge et pI Pureté Analyse de la taille Hétérogénéité de taille Masse moléculaire apparente CE/MS RPLC SEC HILIC AC IEC Agrégation pureté PEGylation Masse moléculaire apparente Hétérogénéité de charge PEGylation Modification post-traductionnelle Déplétion Enrichissement non-utilisée Pureté Produit de dégradation PEGylation UPLC Méthode standard Technique d’avenir Staub et al, J. of Pharm. Biomed. Anal., 2011, 55, 810-822 24 24 24

Le couplage cIEF-ESI/MS Séparation suivant le point isoélectrique des protéines Nature de l’électrolyte support : Anolyte : Acide formique 50 mM Catholyte : Ammoniac 100 mM Ampholyte support Focalisation sous champs puis Mobilisation sous champs et pression Grand champ d’applications : Séparation d’isoformes Détermination de PTMs (Glycosysation, phosphorylation…) Analyse des produits de dégradation Etc… 25 25 25

Séparation de 6 protéines modèles par CIEF-ESI/MS (A) Total-ion electropherogram (TIE) (B) extracted-ion electropherogram (EIE) à m/z 148 pour visualiser la lysine et l’acide glutamique (début et fin du gradient). Condition : voir référence. Milieu glycérol/eau Optimisation de la concentration d’ampholyte Injection de 40% du volume du capillaire Solubilisation, pas EOF Détermination du pI Caractérisation Pureté Minimum de suppression d’ion Focalisation optimale Mokaddem et al, Electrophoresis, 2009, 30, 4040-4048

Applications Chromatographie liquide Electrophorèse CZE/MS 2D Gel CEC CGE CZE/MS Isoforme Charge Produit de dégradation non-utilisée Charge et pI Pureté Analyse de la taille Hétérogénéité de taille Masse moléculaire apparente RPLC SEC HILIC AC IEC Agrégation pureté PEGylation Masse moléculaire apparente Hétérogénéité de charge PEGylation Modification post-traductionnelle Déplétion Enrichissement cIEF non-utilisée Pureté Produit de dégradation PEGylation UPLC Méthode standard Technique d’avenir Staub et al, J. of Pharm. Biomed. Anal., 2011, 55, 810-822 27 27 27

Le couplage CZE-ESI/MS Séparation suivant des différences de mobilités électrophorétiques Nature de l’électrolyte support : Volatile Peu concentré en sel Compatible pour des études en non dénaturant Efficacité inversement proportionnelle au coefficient de diffusion des molécules. Grand champ d’applications : Séparation d’isoformes Détermination de PTMs (Glycolsylation, phosphorlation…) Analyse des produits de dégradation Détermination de constante de stabilité 28 28 28

Comparaison CE/MS et CESI/MS Haselberg et al, J. Chrom., 2010, 1217, 7605-7611

Comparaison CE/MS et CESI/MS 0.999 0.989 0.992 0.997 Faible limite de détection Répétabilité sur les temps de migration Bonne linéarité

Analyse d’hormone de croissance (hGH) par CE-ESI/MS

Analyse d’hormone de croissance (hGH) par CE-ESI/MS Etude de rhGH (recombinant), Tampon ammonium formate pH 8,5 m/z 22124 Structure de la hGH, M : méthionine , N: asparagine, C,: cysctéine Déamidation de l’asparagine Oxydation des méthionines Hypothèse de déamidation Manque de résolution en MS Catai et al. J. Chrom. B., 2006, 852, 160-166

Analyse d’hGH par CE-ESI/MS Différentiation entre hormone endogène et recombinante (rhGH) 22125,46 20270,23 Présence de l’isoforme à 20kDa pour hGH Absence de l’isoforme à 20 kDa pour rhGH Echantillons inconnus = rhGH : LOD déterminé à 50µg/mL Possibilité de diagnostique 22125,68 hGH Unknown 1 22167,28 Unknown 2 rhGH (Humantrope) 22125,05 hGH et rhGH à 200 µg/mL, Tampon ammonium formate pH 8,5, 20% ACN Staub et al. Electrophoresis, 2010, 31, 388-395

Analyse d’hGH par CE-ESI/MS Résolution isotopique de protéines intactes CE-ESI-TOF/MS de rhGH. Tampon ammonium hydrogeno carbonate pH 8,5, A : Simulation de la distribution isotopique de la rhGH B : rhGH intact C : rhGH monodéamidée D : rhGH didéamidée Haute résolution pour des protéines intacts (30kDa) avec TOF MS Taichrib et al. J. of. Proteomics, 2011, 74, 958-966

Caractérisation de « drug-lysozyme » conjugués par CESI-TOF/MS

Caractérisation de « drug-lysozyme » conjugués par CESI-TOF/MS traitement BOC-L-methionine hydroxysuccinimide ester (BOCmet- NHS) : introduction d’un groupement sulfure pour une coordination au platine LZM est une protéine basic pI 11 Greffage positif au polyéthylèneimine BGE, acide acétique 100 mM pH=3,1, 5% isopropanol (A)Voie de synthèse drug-LZM conjugué (B) Représentation schématique de drug-ULS- BOCmet-LZM conjugé (C-E) structures moléculaires de kinase inhibitor LY364947, erlotinib et Y27632. Asterisks = potentiel site de complexation Haselberg et al, Anal. Chim. Acta, 2011, 698, 77-83

Temps de migration (min) Application Caractérisation de « drug-lysozyme » conjugués par CESI-TOF/MS Mw (Da) Temps de migration (min) Aire de pic relatif (%) Assignement 14994.3 8.25 ± 0.03 5.9 ± 0.5 BOCmet3-LZM 14766.1 8.44 ± 0.07 28.9 ± 1.5 BOCmet2-LZM 14535.1 8.69 ± 0.08 37.4 ± 2.8 BOCmet1-LZM 14304.9 9.08 ± 0.08 27.8 ± 1.3 LZM

Temps de migration (min) Application Caractérisation de « drug-lysozyme » conjugués par CESI-TOF/MS Mw (Da) Temps de migration (min) Aire de pic relatif (%) Assignement 14766.2 8.50 ± 0.01 10.7 ± 0.3 BOCmet2-LZM 14535.0 8.82 ± 0.01 21.7 ± 1.1 BOCmet1-LZM 14304.5 9.14 ± 0.01 28.2 ± 0.8 LZM 15033.7 9.47 ± 0.02 20.2 ± 1.0 (drug-ULS)1-BOCmet1-LZM 15264.2 9.18 ± 0.03 16.6 ± 0.3 (drug-ULS)1-BOCmet2-LZM 15764.5 9.89 ± 0.06 2.6 ± 0.2 (drug-ULS)2-BOCmet2-LZM

Complete primary structure of monoclonal antibodies in a single analysis using CESI-MS/MS

mAbs characterization by CESI-MS/MS Monoclonal antibodies (mAbs) have been introduced as therapeutic treatment since 1986 43 marketed mAbs in 2014 more than 30 mAbs in clinical trial phase III mAbs specificity for its antigen opens new avenues for therapeutic treatments oncology autoimmune diseases Transplant rejection prevention mAbs are complex and heterogeneous glycoproteins representing a challenge to analytical sciences Characterization on different level of the mAbs Necessity of precise and high throughput characterization Zhang Z. et al., Mass Spec. Rev., 2009 (28), 147-176

Trastuzumab (Herceptin) LC : -N30T – (D/isoD, +1 Da) HC : -N55T – (D/isoD, +1 Da) HC : -N387T – (D/isoD, +1 Da) Average mass: 148,057 Da (1,328 a.a.) A. Beck et al., Anal. Chem. 2012, 84, 4637-4646

Trastuzumab (Herceptin) LC : -N30T – (D/isoD, +1 Da) HC : -N55T – (D/isoD, +1 Da) HC : -N387T – (D/isoD, +1 Da) Average mass: 148,057 Da (1,328 a.a.) A. Beck et al., Anal. Chem. 2012, 84, 4637-4646

mAbs characterization workflow Primary structure characterization workflow based on bottom-up proteomics strategy Amino acid sequence characterization In-solution tryptic digestion Analysis by t-ITP CESI-MS/MS Glycosylations (structure) PTMs hot spots characterization CESI8000 coupled to 5600 TripleTOF MS

Transient isotachophoresis (t-ITP) Several improvements have been implemented during the development of the CESI-MS/MS methodology Transient isotachophoresis implemented to the method Transient isotachophoresis (t-ITP) is a preconcentration method in CZE to increase sample volume injection likewise separation efficiency leading electrolyte (LE) is ammonium acetate Larsson M. et al, Electrophoresis 2000, 21, 2859-2865

Transient isotachophoresis (t-ITP) Tm = 25.44 min δ = 0.26 min N = 53040 plates Tm = 22.33 min δ = 0.10 min N = 276240 plates Peptide HT07 separated in conventional CZE Peptide HT07 separated using t-ITP CZE Injection up to 25% of capillary volume without losing separation efficiency (2% in conventional CZE) Increases separation efficiency compared to equivalent CZE conditions

Amino acid sequence characterization MS/MS amino acid sequence characterization (trastuzumab) variable domain complementarity determining region constant domain identified peptides 100% sequence coverage achieved in a single injection through only purely tryptic unmodified peptides Gahoual R. et al., Anal. Chem., 2014 (86), 9074-9081

Amino acid sequence characterization APK (m/z 315.2039 ; 2+) MS/MS spectrum of digested peptides LT04 DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK (63 amino acids ; m/z 1119.898 ; 6+) MS/MS spectrum of digested peptides HT15 Implementation of CE allows separation and successful detection of a larger variety of peptides

( > 90% for trastuzumab) Amino acid sequence characterization MS/MS amino acid sequence characterization (trastuzumab) Systematically > 70 % of y/b ions could be retrieved ( > 90% for trastuzumab) Gahoual R. et al., Anal. Chem., 2014 (86), 9074-9081

Glycosylations characterization mAbs glycosylations are characterized simultaneously using the same CESI-MS/MS data CE induces separation of glycopeptides limiting competition during ESI ionization MS/MS spectra exhibited fragmentation of the glycosylation Glycosylation structural characterization obtained from the CESI-MS/MS data Gahoual R. et al., mAbs, 2013 (5), 479-490

Glycosylations characterization Glycopeptides MS signal intensity used to estimate glycoforms relative abundances 15 different glycoforms identified in trastuzumab case Forms containing sialic acid detected Possibility to detect weakly abundant glycosylation Gahoual R. et al., Anal. Chem., 2014 (86), 9074-9081

PTMs hot spots characterization N-terminal glutamic acid cyclization characterization HT01 pyroglu - HT01 Extracted ion electropherograms of peptides HT01 and modified HT01 CE mechanism separates of peptide with N-terminal glutamic acid cyclization from the unmodified peptide Results suggest partial modification of sample Favorable conditions to estimate sample modification level

PTMs hot spots characterization Methionine oxidation Methionine (M) methionine sulfoxide (oxiM) EIEs and MS/MS spectra of peptides HT21 (intact and modified) Methionine oxidation causes peptide mass shift (+15.99 Da) leading to the separation of the modified peptide in CZE confirmed by MS/MS spectra Gahoual R. et al., Anal. Chem., 2014 (86), 9074-9081

PTMs hot spots characterization Asparagine deamidation Asparagine (N) aspartic acid (deaN) EIEs and MS/MS spectra of peptides LT04 (intact and modified) Deamidation (+ 0.98 Da) involves mobility change in CZE enabling the separation of the unmodified peptide CE separation of deamidated peptides eases the identification of the modification by MS Gahoual R. et al., Anal. Chem., 2014 (86), 9074-9081

PTMs hot spots characterization Aspartic acid isomerization HT23 (-D283-) HT23 (-isoD283-) EIEs and MS/MS spectra of peptides HT23 (intact and modified) CE separation prior to MS analysis allows in this particular case to include aspartic acid isomerization in the overall characterization workflow Gahoual R. et al., Anal. Chem., 2014 (86), 9074-9081

mAbs characterization by CESI-MS/MS Results summary obtained with the t-ITP CESI-MS/MS method The t-ITP CESI-MS/MS method developed demonstrated its robustness on different samples including technical replicates in each case Gahoual R. et al., Anal. Chem., 2014 (86), 9074-9081

Single injection (200 fmol) of mAbs digest by t-ITP CESI-MS/MS Conclusion Single injection (200 fmol) of mAbs digest by t-ITP CESI-MS/MS 100% amino acid sequence characterization 15 glycoforms characterization All PTMs hot spots characterization CESI-MS system and conditions provide an excellent ESI ionization yield High sensitivity Positive impact on MS/MS spectra Isomers separation without sample teatment

mAbs biosimilarity assessment As several mAbs patent are ending in the next few months/years, other companies should have the possibility to commercialize « unprotected » mAbs mAbs complexity and production process (cell line selection) makes it nearly impossible to produce strictly the same product as the innovator company FDA and EMA are introducing guidelines to help biopharma companies to determine the key features needed for a biosimilarity between two products in term of structure, PK and PD => reducing clinical trials guidelines biosimilars approval

1st case trastuzumab vs. candidate biosimilar

Amino acid sequence similarity Complete sequence coverage obtained for trastuzumab Biosimilar candidate sequence could be successfully identified except HC K217 Suggesting an amino acid substitution between the two samples Gahoual R. et al., mAbs 2014, in press

Amino acid sequence similarity Interpretation of unidentified MS/MS spectra Unambiguous characterization of the amino acid substitution of biosimilar candidate V D K R217 V E P K rejected candidate CESI-MS/MS spectra of trastuzumab biosimilar candidate Gahoual R. et al., mAbs 2014, in press

Glycoforms characterization Glycosylation distribution evaluated for each sample using CESI-MS/MS data Identification of a significant number of glycoforms Minor differences of glycoforms could be distinguished Gahoual R. et al., mAbs 2014, in press

2nd case cetuximab vs. candidate biosimilar

Amino acid sequence similarity A single analysis of each sample sufficient to conclude on the complete similarity regarding AA sequence Complete sequence coverage is obtained through peptides without miscleavages or PTMs CESI-MS/MS enabled to confirm an error, recently reported in the litterature RGAC D. Ayoub et al., mAbs 2013, 5, 699-710

Glycoforms characterization Fc/2 glycosylation site characterization Cetuximab possess two different N-glycosylation sites Significant number of glycans could be characterized Heterogenous glycoforms could be identified Difference in glycoforms distribution could be observed

Glycoforms characterization Fd glycosylation site characterization Glycoforms exhibited by the candidate biosimilar are significantly different from cetuximab Rejected as biosimilar Capped gal-α1,3-gal glycans significantly reduced 30 % of glycans contains N-acetylneuraminic acid

Trastuzumab vs. Biosimilar Cetuximab vs. Biosimilar Biosimilarity assessment conclusion CESI-MS/MS enabled biosimilarity assessment regarding primary structure and PTMs Trastuzumab vs. Biosimilar 1 amino acids difference Minor differences in glycoforms relative abundances No significant differences in modification levels Cetuximab vs. Biosimilar Complete sequence similarity Glycoforms expressed significantly different No significant differences in modification levels Distinction of significant difference between innovator and candidate Summary of the biosimilarity assessment by t-ITP CESI-MS/MS CESI-MS/MS allowed to conclude in each case on the biosimilarity assessment

Characterization of yeast mitochondrial proteome through CESI-MS workflow

Challenge to analytical sciences ESI LC-MS/MS Steady increase in complexity of samples Challenge to analytical sciences

Yeast Mitochondria Yeast mitochondrial Gln tRNA(Gln) is generated by a GatFAB-mediated transamidation pathway involving Arc1p-controlled subcellular sorting of cytosolic GluRS. Genes & development, Becker et al., 2009

Content of the Study Assessment of capabilities of CESI-MS/MS for the analysis of 100 ng yeast mitochondrial digest NanoLC-MS/MS is performed in parallel as a reference method In the same conditions Using a classical protocol (60 min gradient) Same sample condition: 100 ng mitochondrial yeast digest

Experimental Conditions • CESI-MS/MS Bare Fused Silica Capillary (90 cm*30µm i.d.) BGE: 1% formic acid (pH 2.1) Sample: yeast mitochondrial digest sample 1 µg/µL (100 ng injected) Voltage: 15 kV Current: 2 to 4 µA Distance between capillary tip and MS: 3 to 8 mm Flowrate: <10 nL/min • MS Conditions AB SCIEX TripleTOF 5600 System, positive mode, capillary voltage - 1750V, Curtain gas 5, T=75°C, GS1= 0 Mass range: 150-1250 (TOF-MS), 100-2000 (TOF-MS/MS) IDA Top 20 (duty cycle 2.0 sec, mean spectra rate 12.1 Hz)

Experimental Conditions • NanoLC-MS/MS Eksigent nanoLC 2D plus system with cHiPLC System Pre column: ChromXPC18-CL (200 µm, 0.5 mm, 3 µm, 120Å) Column: ChromXPC18-CL (75 µm, 15 cm, 3µm, 120Å) Gradient: started at 5% B. The concentration of solvent B was increased linearly from 4% to 40% during 50 min and from 50% to 100% during 1 min (solvent A, 0.1% formic acid; solvent B, 0.1% formic acid in 100% acetonitrile) Sample: mitochondrial digest sample 1 µg/µL (100 ng injected) Flowrate: 300 nL/min • MS Conditions AB SCIEX TripleTOF 5600 System, positive mode, capillary voltage 2300 V, Curtain gas 22, T=150°C, GS1= 5 Mass range: 150-1250 (TOF-MS), 100-2000 (TOF-MS/MS) IDA Top 20 (duty cycle 1.6 sec, mean spectra rate 12.1 Hz)

CESI Separation of Mitochondrial Tryptic Digest MS/MS heat map Total ion electropherogram of separation

2774 unique peptides identified CESI Separation of Yeast Mitochondrial Digest Identification results 100 ng of yeast mitochondrial digest injected in CESI-MS/MS Paragon™ Database Search Algorithm in ProteinPilot™ Software Decoy database automatically generated False Discovery Rate < 1% 2774 unique peptides identified 341 proteins identified

1468 unique peptides identified NanoLC Separation of Yeast Mitochondrial Digest Identification results 100 ng of mitochondrial yeast digest injected in NanoLC-MS/MS Paragon Database Search Algorithm in ProteinPilot Software Decoy database automatically generated False Discovery Rate < 1% 1468 unique peptides identified 310 proteins identified

Peptide identifications

3346 unique peptides identified Complementarity NanoLC/CESI Identifications Peptide identifications (in terms of unique peptides) 895 1878 573 CESI-MS/MS NanoLC-MS/MS 3346 unique peptides identified Same sample (yeast mitochondrial digest 1 µg/µL (100 ng injected))

3346 unique peptides identified Complementarity NanoLC/CESI Identifications Peptide identifications (in terms of unique peptides) CESI-MS/MS NanoLC-MS/MS 17% 27% 56% 3346 unique peptides identified Same sample (yeast mitochondrial digest 1 µg/µL (100 ng injected))

Complementarity NanoLC/CESI Identifications Peptide identifications (in terms of unique peptides) CESI-MS/MS nanoLC-MS/MS 17% 27% 56% CESI-MS/MS allowed the detection of additional peptides Same sample (yeast mitochondrial digest 1 µg/µL (100 ng injected))

Complementarity NanoLC/CESI Identifications Peptide masses distribution Number of unique peptides (%) CESI-MS was capable of analyzing small and very large peptides under same experimental conditions

Complementarity NanoLC/CESI Identifications Peptide pI distribution Number of unique peptides (%) CESI-MS was capable of analyzing acidic peptides and basic peptides under same experimental conditions

Protein identifications

Complementarity NanoLC/CESI Identifications Protein identifications 233 108 77 CESI-MS/MS NanoLC-MS/MS 418 Proteins identified Same sample (yeast mitochondrial digest 1 µg/µL (100 ng injected))

Complementarity NanoLC/CESI Identifications Protein identifications CESI-MS/MS NanoLC-MS/MS 18.5% 55.5% 26% CESI-MS/MS allowed to detect additional proteins Same sample (yeast mitochondrial digest 1 µg/µL (100 ng injected))

Summary 56% of peptide id. But only 26% protein id. 895 (27%) 1878 Peptide identification 895 (27%) 1878 (56%) 573 (17%) CESI-MS/MS nanoLC-MS/MS 56% of peptide id. But only 26% protein id. Protein identification CESI-MS/MS nanoLC-MS/MS 77 (18.5%) 233 (55.5%) 108 (26%) Same sample (yeast mitochondrial digest 1 µg/µL (100 ng injected))

Protein Identification m/z=1087.8406 (3+) LGLGGGGDMPGSELADFVENADGFAEVFPQHK pI=4.01 CESI-MS/MS 35 peptides m/z=1087.2262 (3+) DGQLVEIPANEVVPGDILQLEDGTVIPTDGR pI=3.62 m/z=1023.2435 (4+) IVTEDCFLQIDQSAITGESLAVDKHYGDQTFSSSTVK pI=4.23 41% sequence coverage 22% sequence coverage PMA1_YEAST Plasma membrane ATPase 1 nanoLC-MS/MS 19 peptides 3 peptides fragmented above m/z 1,000 3 peptides fragmented below pI 4.3 No peptides fragmented above m/z 1,000

Protein Identification Distribution NanoLC-MS/MS 2 1 5 22 110 56 114

Protein Identification Distribution CESI-MS/MS 8 1 10 50 53 56 162

Comparison NanoLC/CESI Identifications Protein identification distribution CESI-MS/MS number of proteins NanoLC-MS/MS peptides Using CESI-MS proteins could be identified with more confidence due to additional identified peptides

Conclusion CESI-MS/MS generated 2774 peptide IDs corresponding to 341 proteins IDs from 100 ng mitochondrial yeast digest injected CESI-MS was capable of analyzing small and large peptides under same experimental conditions CESI-MS protein could be identified with more confidence due to additional identified peptides

Couplage CE-MALDI-MS

Couplage CE/MS Electrophorèse capillaire (CE) Principe de séparation (Electrocinétique) Bonne efficacité I INTERET min 15 30 45 60 LC CE Séparation sur colonne C4 d’un digestat IdeS de mAbs par LC-MS Séparation d’un digestat IdeS de mAbs par CE-UV/MALDI-MS

Couplage CE/MS Electrophorèse capillaire (CE) Principe de séparation (Electrocinétique) Bonne efficacité MS Sélectivité / Précision (qq ppm) Sensibilité (fmol-Amol) I INTERET DIFFICULTES Maintien du courant Capacité de chargement du capillaire (qq nL) Sels Détergents MALDI- MS plus de tolérance aux sels

Le couplage CE/MALDI –MS Mise au point et évaluation du CE-UV/MALDI-MS SOMMAIRE Le couplage CE/MALDI –MS Mise au point et évaluation du CE-UV/MALDI-MS Mise au point de l’analyse Top DOWN par CE-UV/MALDI-MS

Dépot sur un disque tournant ou sur une boule en rotation Couplage CE/MALDI-MS Direct Preisler, Foret, Karger Anal.Chem. 1998, 70, 5278-5287 Dépot sur un disque tournant ou sur une boule en rotation Bonne sensibilité mais difficile à mettre en place et très faible robustesse 95 95 95

Couplage indirect Collecteur de fraction sans liquide additionnel Busnel, Josserand, Lion, Girault Anal. Chem. 2009, 81, 3867-3872 Dépot sur plaque MALDI Sans liquide additionnel Capillaire conducteur Bonne sensibilité Bonne efficacité Miniaturisation

Collecteur de fraction avec liquide additionnel Couplage indirect Collecteur de fraction avec liquide additionnel Johnson, Bergquist, Ekman, Nordhoff, Schürenberg, Klöppel, Müller, Lehrach, Gobom Anal. Chem. 2001, 73, 1670-1675 Dépot sur plaque MALDI avec liquide additionnel Bonne sensibilité Bonne efficacité Bonne robustesse Capillaire fixe

Le couplage CE/MALDI –MS Mise au point et évaluation du CE-UV/MALDI-MS SOMMAIRE Le couplage CE/MALDI –MS Mise au point et évaluation du CE-UV/MALDI-MS Mise au point de l’analyse Top DOWN par CE-UV/MALDI-MS

Couplage CE/MALDI-MS indirect Autoflex II Bruker HOMEMADE PACE MDQ Beckman Coulter Proteineer FC Bruker Séparation CE Dépôt automatique sur plaque MALDI On-line Off-line Analyse par MS et MSMS

Collecteur de fraction avec liquide additionnel Couplage indirect Collecteur de fraction avec liquide additionnel

Collecteur de fraction avec liquide additionnel Couplage indirect Collecteur de fraction avec liquide additionnel

Schéma du couplage CE-UV/MALDI-MS PACE MDQ Proteineer Détecteur UV ΔV Liquide additionnel Electrolyte support M. Biacchi et al. Electrophoresis 2014, online available

Schéma du couplage CE-UV/MALDI-MS PACE MDQ Proteineer Détecteur UV ΔV Matrice Liquide additionnel Electrolyte support M. Biacchi et al. Electrophoresis 2014, online available

Schéma du couplage CE-UV/MALDI-MS PACE MDQ Proteineer Détecteur UV ΔV Liquide additionnel Matrice M. Biacchi et al. Electrophoresis 2014, online available

Collecteur de fraction avec liquide additionnel Couplage indirect Collecteur de fraction avec liquide additionnel

Analyse de peptides ou de protéines entières

Analyse de peptides ou de protéines entières Différentes stratégies d ’analyses Digestion Sous unités protéiques : mAbs Protéines Entières mAbs Entiers Peptides 10 kDa – 70 kDa 150 kDa 25 kDa – 100 KDa Quelques Da- kDa

M. Biacchi et al. Electrophoresis 2014, online available Protéines entières de 10 kDa – 70 kDa Protéines modèles : 1 Cytochrome C 2 Lysozyme 3 Myoglobine 4 Ribonucléase A 5 α-lactoglobuline Sans dépôt Avec dépôt UV Electropherogram without and with fraction collection) of a five protein sample by CE-UV/MALDI-MS. Experimental conditions: HPC coated capillary, 50 µm d.i. x 60 cm (detection cell, 60 cm); BGE: 83.3mM ionic strength ammonium acetate (pH 4.0); Voltage: 20 kV; Temperature: 25°C; UV Detection: 200 nm; Injection: 3 kV, 8 min Pas d’influence du processus de dépôt M. Biacchi et al. Electrophoresis 2014, online available

M. Biacchi et al. Electrophoresis 2014, online available Protéines entières de 10 kDa – 70 kDa Protéines modèles : 1 Cytochrome C 2 Lysozyme 3 Myoglobine 4 Ribonucléase A 5 α-lactoglobuline 2 14.3 kDa 100 % 3 16.9 kDa 4 13.6 kDa 1 12.3 kDa 5 14.2 kDa CE-MALDI mass spectra of 5 proteins sample. Experimental conditions: HPC coated capillary, 50 µm d.i. x 60 cm (detection cell, 60 cm); BGE: 83 mM ionic strength ammonium acetate (pH 4.0); Voltage: 20 kV; Temperature: 25°C; UV Detection: 200 nm; Injection: 3 kV, 8 min Respect de l’ordre de séparation Respect des masses Absence de contamination M. Biacchi et al. Electrophoresis 2014, online available

Application à un mélange de variants de mAbs entiers

Structure de l’anticorps monoclonal (mabs) Figure fournie par le Centre immunologie Pierre Fabre et Dr Alain Beck Structure complexe de haut poids moléculaire Nombreuses micro hétérogénéités Présence de plusieurs isoformes

1ère séparation CE-MS d’isoformes d’anticorps monoclonaux entiers Isoformes d’anticorps monoclonaux 150 kDa Variants de charge 148320 148268 Électrophérogramme UV (a) and Spectre MALDI-MS correspondant à chaques fractions (b) de variant de mAb entiers par CE-UV/MALDI-MS. Experimental conditions: HPC coated capillary, 50 µm d.i. x 80 cm (detection cell, 70 cm); BGE: 400 mM EACA-acetic acid, 0.05% m/v, pH 5.7; Voltage: 30 kV; Temperature: 25°C; UV Detection: 200 nm; Injection: 2 psi, 30 s; Sample: mAb at 4 g/L 1ère séparation CE-MS d’isoformes d’anticorps monoclonaux entiers M. Biacchi et al. Electrophoresis 2014, online available

Evaluation du système : Peptidomique

M. Biacchi et al. Electrophoresis 2014, online available Mélange de peptides Β Caséine Carbonic anhydrase II Cytochrome C αLactogloguline Lysozyme Albumine bovine Myoglobine Insuline Ribonucléase A Diagramme de Venn representant la comparaison des peptides identifés par CE/MALDI-MS/MS, NanoLC/MALDI-MS/MS et dépot direct MALDI-MS Singularité des techniques Complémentarité des méthodes M. Biacchi et al. Electrophoresis 2014, online available

Combination of the three deposition modes Mélange de peptides CE-UV/MALDI-MS/MS NanoLC/MALDI-MS/MS Direct MALDI-MS Combination of the three deposition modes identified peptides Sequencecoverage (%) βCas 3 22.3 4 20.5 14.7 7 34.4 CAII 20 58.8 11 34.2 5 37.7 28 59.6 Cyt C 13 58.1 43.8 1 10.5 16 74.3 αLac 9 40.8 12 51.4 7.0 18 53.5 Lys 79.6 24 83.0 58.5 41 85.7 BSA 55 73.0 68 77.3 23.6 113 90.1 Myo 15 85.1 6 44.2 19 Ins 100 2 43.1 RNase A 10 25 93.5 8 54.4 32 Total of id. pep. AverageSeq. Cov. (%) 154 64.1 161 60.8 45 27.7 279 75.9 M. Biacchi et al. Electrophoresis 2014, online available

Combination of the three deposition modes Mélange de peptides CE-UV/MALDI-MS/MS NanoLC/MALDI-MS/MS Direct MALDI-MS Combination of the three deposition modes identified peptides Sequencecoverage (%) βCas 3 22.3 4 20.5 14.7 7 34.4 CAII 20 58.8 11 34.2 5 37.7 28 59.6 Cyt C 13 58.1 43.8 1 10.5 16 74.3 αLac 9 40.8 12 51.4 7.0 18 53.5 Lys 79.6 24 83.0 58.5 41 85.7 BSA 55 73.0 68 77.3 23.6 113 90.1 Myo 15 85.1 6 44.2 19 Ins 100 2 43.1 RNase A 10 25 93.5 8 54.4 32 Total of id. pep. AverageSeq. Cov. (%) 154 64.1 161 60.8 45 27.7 279 75.9 CE + LC + Dépôt Direct = Augmentation significative % recouvrement Complémentarité des méthodes M. Biacchi et al. Electrophoresis 2014, online available

Application à un digestat d’anticorps monoclonaux

M. Biacchi et al. Electrophoresis 2014, online available Digestat de mAbs UV Electropherogram corresponding to the analysis by CE-UV/MALDI-MS/MS of mAbtryptic digest Électrophérogramme correspondant à l’analyse par CE-UV/MALDI- MS/MS d’un digestat trypsique de mAbs 92% pour la Chaine Lourde (HC) 100% pour la chaine légère (LC) 92 uniques peptides identifiés 4 N-Glycosylation majeures de mAb M. Biacchi et al. Electrophoresis 2014, online available

Conclusion Développement d’une nouvelle interface CE-UV/MALDI MS Modification de 2 appareils commerciaux Automatisation, Répétable et Robustesse Evaluation du système Mélange des protéines entières jusqu’a 150 kDa Digestat de proteines Complémentarité à la LC-MS

Le couplage CE/MALDI –MS Mise au point et évaluation du CE-UV/MALDI-MS SOMMAIRE Le couplage CE/MALDI –MS Mise au point et évaluation du CE-UV/MALDI-MS Mise au point de l’analyse Top DOWN par CE-UV/MALDI-MS

L’analyse Top Down par MALDI-MS Fragmentation ISD : sequence en AA Nécessité de concentration suffisante (pmol) Nécessité de séparer les protéines Collecte et Enrichissement par CE/MALDI-MS

sur un mélange de protéines de référence Evaluation du système sur un mélange de protéines de référence

Séparation, Enrichissement, Top-Down d’un mélange de 5 protéines Protéines modèles : 1 Cytochrome C 2 Lysozyme 3 Myoglobine 4 Ribonucléase A 5 αlactoglobuline Conditions : Injection : 5kV 8 min ; tampon : 83 mM de force ionique d’une solution d’acétate d’ammonium à pH=4 ; Lt= 60 cm, ld= 53 cm, Φ = 50 µm ; greffage : HPC, UV à 200 nm, 25°C. (1) 40 nM Cyt c, (2) 40 nM Lys, (3) 50 nMMyo, (4) 50 nMRnase A and (5) 120 nM αLac dans l’eau Répétabilité RSD < 2% sur temps de migration Enrichissement directement sur plaque MALDI

Séparation, Enrichissement, Top-Down d’un mélange de 5 protéines Cytochrome C 1 dépôt (1 pmol) 3 dépôts Superposition des spectres de masse du cytochrome C à 1 (Rouge) et 3 (Bleu) répétitions ; Puissance laser : 71% Matrice : 2,5-dihydroxybenzoïque (DHB) (saturé) dans du TA30 (0.1%TFA, 70% eau et 30% acétonitrile). Absence d’effet mémoire Augmentation du signal en fonction du nombre du dépôt Enrichissement

caractérisation Top Down de protéine par CE/MALDI-MS/MS Séparation, Enrichissement, Top-Down d’un mélange de 5 protéines 100 % 1500 2000 2500 3000 3500 4000 m/z 3 dépôts 4500 Cytochrome C Identification de 39 résidus correspondant à la séquence de la Cytochrome C caractérisation Top Down de protéine par CE/MALDI-MS/MS