La présentation est en train de télécharger. S'il vous plaît, attendez

La présentation est en train de télécharger. S'il vous plaît, attendez

Prédiction de la structure 3-D des protéines. Swissprot +/- 200.000 séquences Protein Data Bank +/- 30.000 structures Analyse de séquence Recherche de.

Présentations similaires


Présentation au sujet: "Prédiction de la structure 3-D des protéines. Swissprot +/- 200.000 séquences Protein Data Bank +/- 30.000 structures Analyse de séquence Recherche de."— Transcription de la présentation:

1 Prédiction de la structure 3-D des protéines

2 Swissprot +/ séquences Protein Data Bank +/ structures Analyse de séquence Recherche de fonction Analyse dhydrophobicité (PO, TM, H amphip.) Prédiction de sites dinteractions Prédiction de sites antigéniques Prédiction de structures secondaires … Analyse de structure 3D Etude des interactions (3D / 4D) Etude du site actif Docking Dynamique, modifications Etude des interactions avec une membrane Ingénierie des protéines Etude du folding … Introduction

3 Détermination expérimentale coûteuse et pas toujours possible… Détermination expérimentale de la structure dune protéine

4 Prédiction de structures 3D Modélisation par homologie : Identification dune protéine de structure connue de séquence homologue Fold recognition ou threading : Se base également sur la connaissance de structures 3D de protéines. On essaie de déterminer le fold de la protéine. Ab initio : Construction de modèles 3D sur base de la séquence par simulation des forces qui gouvernent le repliement pour trouver la structure de plus basse énergie.

5 Principe de la modélisation par homologie Structures mieux conservées que séquences ! Si homologie entre séquences => homologie entre structures => prédiction modèle 3D par homologie possible

6 Si identité > 30% => OK Si 20% + difficile / risqué Si identité +++ difficile / impossible Estimation : 28% des séquences ont au moins 25% ID avec une protéine de structure connue (PDB) Protéine homologue dans la PDB ??? Principe de la modélisation par homologie

7 Etapes de la prédiction du modèle 3D 1.Identification dune protéine de structure connue de séquence homologue (ou plusieurs !) 2.Alignement Target / Template(s) 3.Construction du modèle 3D 4.Optimisation du modèle 3D 5.Validation du modèle 3D ! Étapes 1 et 2 déterminantes !

8 1. Recherche de séquence(s) homologue(s) dans la PDB Cfr. cours sur les méthodes dalignement. Utilisation dun algorithme pour chercher des protéines de structure connue qui ont une séquence homologue à notre séquence target et qui pourront ainsi être utilisées comme template.

9 Alignements 4. Comparaison de séquences : les alignements = une des premières étapes dans lanalyse des séquences = comparaison de séquences dans le but de repérer les endroits où se trouvent des régions identiques ou très similaires entre des séquences et den déduire celles qui sont significatives et qui correspondent à un sens biologique de celles qui sont observées par hasard. Séquence1 LRTMPDSYGWPLVGPLSDRLDYFFFQITRAEKNIPPTFGN Séquence2 IKTMPERYGSEIISPGDEGWLYLYHNIEHFQKYLPIYLGN Séquence1 LRTMPDSYGWPLVGPLSDRLDYFFFQITRAEKNIPPTFGN *** ** * * * * * ** Séquence2 IKTMPERYGSEIISPGDEGWLYLYHNIEHFQKYLPIYLGN Séquence1 LRTMPDSYGWPLVGPLSDRLDYFFFQITRAEKNIPPTFGN..***. **.. *. *..*..*.* ** Séquence2 IKTMPERYGSEIISPGDEGWLYLYHNIEHFQKYLPIYLGN % identité = 30% % similarité = 57% similarité homologie homologie si ancêtre commun homologie mesurée par similarité

10 Alignements Objectif : Révéler des informations importantes sur la structure, la fonction lévolution de ma(mes) séquence(s) dintérêt Quelqu'un a t-il déjà rencontré ce type de séquences ? Si oui, je vais pouvoir avoir rapidement accès à toutes ses connaissances !!

11 Alignements : principes Principe des alignements Durant lévolution, substitutions de résidus Subsitution homologue Substitution non homologue insertions / délétions de résidus Séquence1 LRTMPDSYGWPLVGPSDRDLYLFHQITRAEKNIPPTFGNF..***. **.. * * *. Séquence2 IKTMPERYGSEIISPGDEKELYLYHNIEHFQKYLPIYLGN Séquence1 LRTMPDSYGWPLVGPSD-RDLYLFHQITRAEKNIPPTFGNF..***. **.. * *..***.*.*..*.* ** Séquence2 IKTMPERYGSEIISPGDEKELYLYHNIEHFQKYLPIYLGN- Représente une insertion-délétion (indel ou gap) => Calcul dun score pour évaluer la qualité de lalignement

12 Détermination dun score Utilisation de matrice de substitution Calcul dun score score global = la somme des scores élémentaires Score = se Introduction de gap (avec pénalité) Pénalité pour linsertion dun gap (x) Pénalité pour lextension dun gap (y) (svt x = 10 y) P = coût global du gap de longueur L P = x + yL Score = se - P Le score élémentaire (se) = la valeur donnée directement dans la matrice Alignements : principes

13 Identité Homologie *Similarités physico-chimiques *Matrice dévolution (probabilité quun A.A. soit muté en un autre après un temps dévolution donné) (PAM, Blosum) *Matrice basée sur la comparaison des séquences (Gonnet) Matrices de substitution Alignements : principes

14 The PAM250 scoring matrix Alignements : principes

15 Matrices protéiques utilisées Pam 120 Pam 250 blossum 50 blossum 62 blossum 80 Gonnet matrix Le choix d'une matrice protéique Pas de consensus, mais ce qui est généralement reconnu... Matrices Blosum > matrices Pam Matrice Blosum62 = la meilleure pour la détection de la majorité des similarités protéiques faibles. Matrice Blosum45 = la meilleure pour la détection de la majorité des similarités protéiques faibles et longues. Alignements : principes

16 Alignements : principe Alignement global alignement local

17 !!! ce critère doit être relié à la longueur de la similitude au nombre dinsertion introduite Généralement reconnu : Des séquences protéiques de 100 aa ou plus possédant au moins 25% didentité entre elle ont certainement un ancêtre commun. On peut douter dun alignement sil nécessite plus dune insertion en moyenne pour 20 acides aminés. Alignements : évaluation

18 E-value E = Y Z K e - S s = score authentique Y = longueur de la séquence Z = taille de la banque K et = constante E = Probabilité d'observer au hasard ce score à travers la banque de séquences considérée. Plus la E-value est faible, plus l'alignement est significatif. Fasta Blast Pour les programmes dalignements suivants, on considère que :

19 Alignements : type Type dalignement Alignement entre une séquence et une banque Fasta Blast Alignement entre deux séquences = alignement pairé SIM Alignement entre plusieurs séquences = alignement multiple ClustalW Match-box Dialign 2

20 2. Alignement des séquences target / template Si un ou plusieurs template ont été identifiés, il faut générer un alignement entre les séquences target et template. Questions : Quel(s) algorithme(s) utiliser ? Quels paramètres utiliser ? Comment juger de la pertinence des résultats ? Comment améliorer lalignement ?

21 Quel(s) algorithme(s) utiliser ? Quels paramètres utiliser ? Comment juger de la pertinence des résultats ? Comment améliorer lalignement ? 2. Alignement des séquences target / template - Clustal, MatchBox,… - comparaisons et combinaisons possibles - alignement structural si plusieurs templates - en fonction des cas… - % ID, % homologie, gaps et positions - alignement de résidus particuliers - Homologie HCA - Structures secondaires,… - cfr. ci-dessus

22 Construction dun modèle 3D - séquence Target - structure Template - alignement Target/Template 3. Construction du modèle 3-D 4. Optimisation du modèle 3-D Optimisation de la géométrie par minimisation énergétique 5. Validation du modèle 3-D Calcul de paramètres pour juger de la validité du modèle Confrontation à des données expérimentales

23 => Contraintes spatiales = fonction de densité de probabilité (pdf) Contraintes : - basées sur lalignement - stéréochimiques - utilisateur éventuelles Modeller Comment ? modèle 3D - séquence Target - structure Template - alignement

24 Principe de développement de Modeller Utilisation dune base de données de protéines de structure connue correspondant à des protéines homologues réparties en familles. Cette base de donnée sert à déterminer : - les paramètres (caractéristiques) relevants à utiliser lors de la prédiction - comment utiliser ces paramètres Les paramètres relevants sont déterminés par des méthodes statistiques (sans à priori). Une fois les paramètres relevants déterminés, la base de données est utilisée pour déterminer les fonctions de densité de probabilité qui décrivent le lien entre les paramètres.

25 Contraintes basées sur lalignement Notion de « caractéristique » = paramètre = propriété associée à un élément simple ou relation entre plusieurs éléments = relative à un résidu, à plusieurs résidus, à une protéine, ou à deux séquences Exemples : acide aminé, accessibilité au solvant dans la structure, distance entre deux C, résolution de la structure, identité entre séquences,… Définition de 21 caractéristiques

26 1rAmino acid residue type 2 Main-chain dihedral angle 3 Main-chain dihedral angle 4tSecondary structure class of a residue 5MMain-chain conformation class of a residue 6 Fractional content of residues in the main-chain conformation class A 7 i Side-chain dihedral angle i, i = 1, 2, 3, 4 8cici Side-chain dihedral angle i class, i = 1, 2, 3, 4 9aResidue solvant accessibility 10aAverage accessibility of two residues in one protein 11sResidue neighbourhood difference between two proteins 12sAverage residue neighbourhood difference between two proteins 13iFractional sequence identity between two proteins 14d C -C distance 15 dDifference between two C -C distances in two proteins 16hMain-chain N-O distance 17 h Difference between two main-chain N-O distances in two proteins 18bAverage residue B iso (atomic isotropic temperature factor) 19RResolution of X-ray analysis 20gDistance of a residue from a gap in alignement 21gAverage distance of a residue from a gap

27 Formulation des contraintes ? Contrainte = fonction (pdf) qui établit une relation entre différentes caractéristiques Quest-ce quune contrainte ? 1. Quantification de lassociation entre les caractéristiques caractéristiques dépendantes ou indépendantes ? 2. Définition dune fonction mathématique expression de la contrainte = pdf Contraintes basées sur lalignement

28 Banque de 17 familles de protéines de structure connue = 80 protéines alignées Table multidimensionnelle des fréquences relatives observées pour la caractéristique x en fonction des caractéristiques a, b, c,… Tests statistiques pour mesurer la dépendance de x par rapport à a, b, c,… Formulation des contraintes ? caractéristiques dépendantes ou indépendantes ?

29 4 types de contraintes sont définies : - sur les distances C -C - sur les distances O-N (main-chain) - sur la conformation de la chaîne principale - sur la conformation des chaînes latérales Exemple : Contrainte sur distance C - C dans Target exprimée sour forme de fonction de densité de probabilité (pdf)… => probabilité que dist(C - C ) = x dépend de - distance entre C équivalents dans Template - accessibilité des C équivalents dans Template - homologie de séquence Target/Template - distance moyenne aux gaps dans lalignement Contraintes basées sur lalignement Résultat :

30 pdfs des caractéristiques => pdf moléculaire « Variable Target Function Approach » pondération des pdfs des caractéristiques au cours de la recherche de la structure de plus grande probabilité Contraintes locales (en terme de séquence) => Contraintes globales Comment combiner les contraintes des caractéristiques pour la molécule ?

31 Evaluation de Modeller - Choix de la structure Template ! - Qualité de la structure Template ! - Qualité de lhomologie ! - Qualité de lalignement ! Résidus enfouis mieux prédits que résidus accessibles Zones de faible homologie moins bien prédites

32 Swiss Model & Swiss PDB Viewer Serveur de modélisation par homologie automatisée accessible à ladresse : ou via Swiss PDB Viewer (Deep View)

33 Modeller Swiss Model Modeller : Lentièreté de la structure de la protéine est modélisée en utilisant des contraintes dérivées des structures templates. Swiss Model : La prédiction de la structure de la protéine se base sur un découpage de la protéine en des régions conservées et des régions variables qui sont modélisées séparément. => assemblage de fragments basés sur les structures templates.

34 Swiss Model : méthode 1. Identification de fragments de structure conservée 2. Construction du cœur du modèle : - Position moyenne des atomes du backbone du cœur des templates avec pondération en fonction de la similarité séquence target / template - Les régions non conservées (boucles) sont laissées pour plus tard…

35 Swiss Model : méthode 2. Construction du cœur du modèle3. Modélisation des boucles : - recherche de fragments compatibles dans une banque de donnée de boucles (Loop-database) - reconstruction ab initio pour les boucles manquantes

36 4. Positionnement des chaînes latérales On recherche la conformation la plus probable pour chaque chaîne latérale en utilisant : - les structures homologues - des banques de rotamères - des critères énergétiques Swiss Model : méthode 3. Modélisation des boucles

37 Swiss Model : méthode 4. Positionnement des chaînes latérales5. Minimisation énergétique - régularisation de la géométrie (longueurs de liaisons et angles) - suppression des conflits stériques

38 Prédiction de structures 3D Modélisation par homologie : Identification dune protéine de structure connue de séquence homologue Fold recognition ou threading : Se base également sur la connaissance de structures 3D de protéines. On essaie de déterminer le fold de la protéine. Ab initio : Construction de modèles 3D sur base de la séquence par simulation des forces qui gouvernent le repliement pour trouver la structure de plus basse énergie.

39 FOLD = Type de repliement Certaines protéines (même non- homologues) adoptent le même fold. La PDB regroupe environ structures, ce qui fait environ folds.

40 Fold recognition 1.Identification du template (fold de la protéine) 2.Alignement Target / Template(s) 3.Construction du modèle 3D 4.Optimisation du modèle 3D 5.Validation du modèle 3D Idem que pour modélisation par homologie On impose différents folds à la séquence On calcule un score pour mesurer ladéquation structure séquence On optimise lalignement pour la structure ayant le meilleur score On effectue une analyse statistique des résultats On essaie de prédire le fold compatible avec la séquence de la protéine sans tenir compte de lhomologie de séquence Méthode :

41 Validation des structures 3D Comparaison des modèles prédits Comparaison au(x) Template(s) Stéréochimie acceptable ? (Procheck) - conflits stériques - longueurs de liaison, angles de valence,… - carte de Ramachandran - … Mesure de ladéquation entre la structure et la séquence Confrontation à des résultats expérimentaux …

42 Comparaison de structures 3 modèles prédits par Modeller

43 Stéréochimie (Procheck)

44


Télécharger ppt "Prédiction de la structure 3-D des protéines. Swissprot +/- 200.000 séquences Protein Data Bank +/- 30.000 structures Analyse de séquence Recherche de."

Présentations similaires


Annonces Google