La présentation est en train de télécharger. S'il vous plaît, attendez

La présentation est en train de télécharger. S'il vous plaît, attendez

Introduction à la génomique structurelle Nadia El-Mabrouk Mathieu Lajoie.

Présentations similaires


Présentation au sujet: "Introduction à la génomique structurelle Nadia El-Mabrouk Mathieu Lajoie."— Transcription de la présentation:

1 Introduction à la génomique structurelle Nadia El-Mabrouk Mathieu Lajoie

2 Rappel – Structure des protéines Structure primaire TIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEVNALKNEILK Structure secondaire Hélice alpha Feuillet bêta

3 Rappel – Structure des protéines Structure tertiaire Conformation dun seul polypeptide

4 Rappel – Structure des protéines Structure quaternaire Plusieurs polypeptides

5 Classification SCOP Classes Folds Super familles Familles All alpha proteins All beta proteins Alpha and beta proteins (a/b) Mainly parallel beta sheets (beta-alpha-beta units) Alpha and beta proteins (a+b) Mainly antiparallel beta sheets (segregated alpha and beta regions) Multi-domain proteins (alpha and beta) Folds consisting of two or more domains belonging to different classes Membrane and cell surface proteins and peptides Does not include proteins in the immune system Small proteins Usually dominated by metal ligand, heme, and/or disulfide bridges

6 Classification SCOP Fold: Similarité de structure évidente Deux protéines ont un repliement (fold) commun si elles ont les mêmes éléments de structure secondaire arrangés de la même façon Nont pas nécessairement la même origine évolutive, ni la même fonction. Classes Folds Super familles Familles

7 Classification SCOP Classes Folds Super familles Familles Super famille: Origine évolutive commune probable Protéines ayant un faible taux didentité de séquence, mais dont la structure et la fonction suggèrent une origine évolutive commune

8 Classification SCOP Classes Folds Super familles Familles Famille: Relation évolutive évidente Identité de séquence supérieure à 30%. Dans certains cas, de fortes similarités de structure et de fonction permettent dinclure des protéines ayant un faible taux didentité de séquence (de lordre de 15%)

9 Pourquoi aligner des structures? Pour des protéines évolutivement éloignées, la comparaison de séquences ne permet pas didentifier des similarités de fonction. Des protéines ayant des séquences complètement différentes peuvent avoir des structures et des fonctions similaires.

10 Alignement de structures de protéines DALI: Basé sur la comparaison de matrices de distances 2D. Ces matrices contiennent les distances entre les carbones alpha à lintérieur de la protéine. Pour comparer la structure de deux protéines, on compare leurs matrices de distances 2D.

11 Exemple 2 1 3

12 Mesure de similarité RMSD Root mean squared distance RMSD Lorsque deux structures sont superposées, cette mesure est la racine de la somme des distances entre atomes équivalents, au carré.


Télécharger ppt "Introduction à la génomique structurelle Nadia El-Mabrouk Mathieu Lajoie."

Présentations similaires


Annonces Google