La présentation est en train de télécharger. S'il vous plaît, attendez

La présentation est en train de télécharger. S'il vous plaît, attendez

Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Djamel Drider – Ph.D Unité de Recherche.

Présentations similaires


Présentation au sujet: "Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Djamel Drider – Ph.D Unité de Recherche."— Transcription de la présentation:

1 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Djamel Drider – Ph.D Unité de Recherche Biotechnologie de la Reproduction ONIRIS - Nantes ou Quimper / 18 Novembre 2010

2 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » La divercine V41 une bactériocine utilisable dans les domaines de la sécurité alimentaire et de «lantibiothérapie » Les travaux présentés dans le cadre de cette présentation ont été réalisées au laboratoire de Microbiologie Alimentaire et Industrielle de lENITIAA de Nantes. Grand Merci à tous les étudiants et collègues avec qui jai pu travailler sur ce projet

3 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Problématique scientifique Recrudescence de la multirésistance bactérienne aux antibiotiques conventionnels Sécurité microbiologique des aliments Multiplication des infections bactériennes - Campylobacter jejuni - Listeria monocytogenes - Salmonella enterica

4 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Figure extraite de Quadri et al. Infect Disord Drug Targets Sep;7(3): Augmentation de lincidence des infections à bactéries multirésistantes

5 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Diminution du nombre de nouvelles molécules antibiotiques Figure extraite de Belguesmia-Naghmouchi-Chihib-Drider In Drider and Rebuffat – Springer 2011

6 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Autorité européenne de sécurité des aliments (European Fodd Safety Authorithy) En cas dinfections à Campylobacter cas dinfections à Salmonella 1381 cas dinfections à Listeria Campylobacter Salmonella Listeria

7 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Les bactériocines produites par les bactéries lactiques sont: – - synthétisées par voie ribosomique (RPS) – - secrétées dans le milieu extracellulaire… Lactivité bactéricide est dirigée contre des souches taxonomiquement proches de l'organisme producteur mais …. Définition des bactériocines

8 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » – Classe I / modifications post-traductionnelles – Acides aminés inhabituels (Lanthionines et β - methyllanthionine) – Lantibiotiques (Nisine) / additif alimentaire EC 234 Principales classes des bactériocines Structure 3D de la nisine (Hsu et al., 2004)

9 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Principales classes des bactériocines Helv é ticine J Lactobacillus helveticus Zoocine AStreptococcus zooepidermicus Ent é rolysine A Enterococcus faecalis Mill é ricine B Streptococcus milleri Linocine M18Brevibacterium linens Classe III / Bactériolysines -- PM > 10kDa -- Thermolabiles -- Agissent sur la paroi bactérienne en hydrolysant le peptidoglycane

10 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Principales classes des bactériocines Classe II / -- Peptides non lantibiotiques (pas d acides amin é s modifi é s) -- PM < 10kDa -- Stables à la chaleur et aux pH extrêmes - Lactoccine A- Entérocine AS-48 - Carnocycline A - Lactocycline Q - Entérocine L50A/L50B - Lactococcine G - Lactococcine Q - Pédiocine PA-1 - Divercine V41 - Entérocine A Classe IIdClasse IIc Bactériocines circulaires Classe IIb Bactériocines à deux composantes Classe IIa Pediocin-like

11 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Structure secondaire des bactériocines de classe IIa Pédiocine box Feuillet β Hélices α NC YGNGV KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC Pédiocine PA-1 Henderson et al., 1992

12 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Structure 3D des bactériocines de classe IIa Curvacine A -En région N-terminale : Structure en coude β, portant le motif YGNGVxCx4C. - En région C-terminale : Hélices α hydrophobes qui interagissent avec la membrane N C Haugen et al., 2005 YGNGV

13 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Mode daction des bactériocines de classe IIa Formation de poresRécepteur membranaire

14 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Milieu extracellulaire Milieu intracellulaire Agrégation et formation du pore Mort cellulaire Milieu intracellulaire Milieu extracellulaire K +, Acide aminés, phosphate inorganique, ATP Modèle de Wedge Milieu intracellulaire Naghmouchi Drider and Fliss I.(2007) J. Applied Microbiology. 102: Milieu extracellulaire Milieu intracellulaire

15 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Récepteur membranaire Héchard et al., Microbiology 147, Drider et al., Microbiol Mol Biol Rev. 70,

16 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Voie de synthèse Spectre daction Concentration requise pour lactivité Différences entre bactériocines et antibiotiques ! Ingolf Nes in Drider and Rebuffat. (2011)

17 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Divercine V41 / modèle dinvestigation Bactériocine de classe IIa Carnobacterium divergens V41 (bactérie lactique isolée de viscères de poisson) La divercine V41 possède: - une activité anti-Listeria très élevée - deux ponts disulfure importants pour lactivité antibactérienne - des acides aminés essentiels : tyrosine (Y) et tryptophane (W) TKYYGNGVYCNSKKCWVDWGQASGCIGQTVVGGWLGGAIPGKC

18 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Etude structure fonction Clivage par une endoprotéase Asp-N N-term hydrophile C-term hydrophobe Bhugaloo-Vial et al., 1999 (Appl. Environ. Microbiol.) Activité anti-Listeria Pas dactivité anti-Listeria Rôle important des acides aminés aromatiques 1 Trp 3 Tyr Réduction chimique des ponts disulfures perte de lactivité anti-Listeria une perte totale de lactivité

19 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » DvnRV41 AMDPTKYYGNGVYCNSKKCWVDWGQASGCIGQTVVGGWLGGAIPGKC W19FTKYYGNGVYCNSKKCWVD F GQASGCIGQTVVGGWLGGAIPGKC Q21S TKYYGNGVYCNSKKCWVDWG S ASGCIGQTVVGGWLGGAIPGKC A22GTKYYGNGVYCNSKKCWVDWGQ G SGCIGQTVVGGWLGGAIPGKC S23YTKYYGNGVYCNSKKCWVDWGQA Y GCIGQTVVGGWLGGAIPGKC V30FTKYYGNGVYCNSKKCWVDWGQASGCIGQT F VGGWLGGAIPGKC L35FTKYYGNGVYCNSKKCWVDWGQASGCIGQTVVGGW F GGAIPGKC A38VTKYYGNGVYCNSKKCWVDWGQASGCIGQTVVGGWLGG V IPGKC P40VTKYYGNGVYCNSKKCWVDWGQASGCIGQTVVGGWLGGAI V GKC Synthèse des variants structuraux de DvnRV41 Aa / Divercine V41 Aa / bactériocines de classe IIa Rihakova J, Petit VW, Demnerova K, Prévost H, Rebuffat S, Drider D. (2009) Appl Environ Microbiol.75:

20 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Peptides Acide aminé Changé L. monocytogenes EGDe DvnRV41None0.1 ± 0.01 variant 1W19F21.1 ± 0.9 variant 2Q21S18.3 ± 0.9 variant 3A22G8.6 ± 0.01 variant 4S23Y0.1 ± 0.01 variant 5V30F1.3 ± 0.4 variant 6L35F0.7 ± 0.2 variant 7A38V1.5 ± 0.4 variant 8P40V2.5 ± 0.9 DvnRV41 et variants structuraux / CMIs (µg/ml) de Rihakova J, Petit VW, Demnerova K, Prévost H, Rebuffat S, Drider D. (2009) Appl Environ Microbiol.75:

21 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Consommation de saumon Produit de consommation quotidienne ! En France la consommation [20,000,000 kgs/an] (augmentation de la consommation nationale dun facteur de 6 depuis 1980 Production UE est leader dans le monde [80%] Production Française (40 entreprises / 300,000,000 ) Sources bibliographiques variées et à actualiser

22 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Contamination des aliments et infection 100 bactéries Gramme daliment Risque Infection Listérioses Traitement Production de DvnV41 Tirer Cb. divergens V41 L. monocytogenes

23 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Microflore du saumon fumé Les Bactéries à Gram Négatif Les Bactéries à Gram Positif A la sortie de lusine / La contamination des produits peut atteindre 10 2 à 10 6 UFC/g (Unités formant colonies) La microbiologie du saumon Sources bibliographiques variées et à actualiser

24 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Les bactéries à Gram Négatif Photobacterium phosphoreum Shewanella putrefaciens Vibrio spp. Serratia liquefaciens Acetinobacter spp. Hafnia alvi Enterobacter agglomerans Proteus mirabilis Proteus vulgaris Pseudomonas spp. Moraxella spp. Aeromonas spp Après le fumage et au moment du conditionnement Sources bibliographiques variées et à actualiser

25 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » -Altération des qualités organoleptiques du poisson Poissons frais: Le Cabillaud, Lee Hareng, Le Bar Poissons fumés: Le Saumon -Production de TMA (Triméthylamine) -Production dH 2 S et odeurs putrides dans le saumon fumé Shewanella putrefaciens Impact de la Flore à Gram Négatif Photobacterium phosphoreum -Altération des qualités organoleptiques du poisson* Emballé sous atmosphère modifiée et calamar -Production de TMA (Triméthylamine) -Production damines biogènes (histamine) Sources bibliographiques variées et à actualiser

26 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Les bactéries lactiques Les Bactéries à Gram Positif Brochotrix thermosphacta Carnobacterium piscicola Carnobacterium divergens Lactobacillus alimentarius Lactobacillus bavaricus Lactobacillus curvatus Lactobacillus homohiochii Lactobacillus casei subsp. tolerans Lactobacillus coryneformis Lactobacillus farciminis Lactobacillus plantarum Lactobacillus sakei Lactococcus sp. Leuconostoc carnosum Leuconostoc mesenteroides Sources bibliographiques variées et à actualiser

27 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Maladie à déclaration obligatoire depuis décès au Canada (Eté 2008) Taux de mortalité avoisinant les 30 % chez la femme enceinte 220 cas sporadiques de listériose recensés par an en France. La listériose Informations génériques disponibles en ligne

28 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Bactérie à Gram positif, distribution ubiquitaire Températures de développement 4 à 45°C. Concentrations en NaCl tolérées 10 à 20%. Cette bactérie à des capacités dadaptation extraordinaires Gandhi M, Chikindas ML. Int J Food Microbiol Jan 1;113(1):1-15. Epub 2006 Sep 28. Review. Systématique et bactériologie Listeria monocytogenes Colonies typiques sur gélose sélective

29 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Relation listériose et consommation de saumon ou de truite fumés Suède 9 personnes touchées dont 2 décès Finlande: 23 cas de listériose ont été recensés en Finlande entre juin 1999 et Février 2000, probablement liés à lingestion de poisson fumé ou salé à froid. Normes ! Pas daccord international sur le niveau acceptable de L. monocytogenes Remarque / En France et dans dautres pays Européens, la législation tolère jusquà 100 UFC/g dans le saumon fumé à la DLC à condition que les entreprises ait effectué des études vieillissement de leurs produits prouvant que le seuil de 100 UFC/g nest jamais dépassé à la DLC. (AFSSA, 2000; DGAL N98/N°8088, 1998).

30 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Inhibition de L. monocytogenes dans le saumon fumé (BRILLET et al, JAM. 97: ) Listeria monocytogenes L. monocytogenes Cb. divergens V Temps (jours) log 10 (UFC/ g saumon) 1 UFC/g

31 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Origine de cette inhibition ? Action inhibitrice de DvnV41 (in situ)? Compétition nutritionnelle entre L. monocytogenes et Cb. divergens V41 ? Isolement et caractérisation dune souche mutante déficiente dans la production de la divercine V41

32 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » 1 23 Souche cible = Listeria monocytogenes Antagonisme microbien par production de peptide Test de diffusion sur boite Souche 1 Cb. divergens NCDO2763 (contrôle) Souche 3 Cb. divergens V41C9 (souche mutante) Souche 2 Cb. divergens V41 (souche sauvage) Richard C, Brillet A, Pilet MF, Prévost H, Drider D Lett Appl Microbiol. 36:

33 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Enzyme-Linked ImmunoSorbent Assay 0 0,5 1 1,5 2 2,5 123 DO 405 nm Souche 1 Cb. divergens NCDO2763 (contrôle) Souche 3 Cb. divergens V41C9 (souche mutante) Souche 2 Cb. divergens V41 (souche sauvage) Richard C, Brillet A, Pilet MF, Prévost H, Drider D Lett Appl Microbiol. 36:

34 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » 400 pb 300 pb 200 pb 1 23 Approche moléculaire (Amplification et séquençage du gène dvnV41 Souche 1 Cb. divergens NCDO2763 (contrôle) Souche 3 Cb. divergens V41C9 (souche mutante) Souche 2 Cb. divergens V41 (souche sauvage) Richard C, Brillet A, Pilet MF, Prévost H, Drider D Lett Appl Microbiol. 36:

35 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » L. monocytogenes L. monocytogenes + C.b divergens V41C9 Souche mutante L. monocytogenes + Cb. divergens V41 Souche sauvage Richard C, Brillet A, Pilet MF, Prévost H, Drider D Lett Appl Microbiol. 36:

36 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » C. divergens V41 autres Carnobacterium ssp Suivi de limplantation de C. divergens V41, parmi la flore lactique du saumon fumé inoculé, par la technique de PCR-Multiplex Sur colonies de la flore lactique Connil N, Prévost H, Dousset X J Appl Microbiol.92:

37 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Expériences sur les animaux (souris, Balb/c) ont été réalisées dans le respect des principes éthiques fondamentaux. Activité In-vivo de la divercine recombinante Rihakova J, Cappelier JM, Hue I, Demnerova K, Fédérighi M, Prévost H, Drider D Antimicrob Agents Chemother. 54:

38 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Strat é gie exp é rimentale sur mod è le murin « in vivo » Utilisation DvnRV41 et peptides altérés (W19, Q21, A22, P40) Protocole expérimental (Ingham et al. 2003; modifié) Rihakova J, Cappelier JM, Hue I, Demnerova K, Fédérighi M, Prévost H, Drider D Antimicrob Agents Chemother. 54:

39 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » T= 0: Injection iv. de L. monocytogenes EGDe 1,5 x 10 3 UFC/ml T= 30 min : Injection iv de peptides (2 µg/50 µl) Peptides injectés (DvnRV41; W19F; Q21S, A22G, P40V) Groupes 1 à 5 / (Post challenge test)

40 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » T= - 15 min: Injection iv de peptides (2 µg/50 µl) T= 0 min : Injection iv de L. monocytogenes 1,5 x 10 3 UFC/ml Groupes 6 – 10 / (Pré challenge test) Rihakova J, Cappelier JM, Hue I, Demnerova K, Fédérighi M, Prévost H, Drider D Antimicrob Agents Chemother. 54:

41 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » OBSERVATION des souris pendant 72 heures - Diarrhée - Vomissement - Dépression Euthanasie par dislocation cervicale - Extraction organe (rate) - Isolement et dénombrement de L. monocytogenes Rihakova J, Cappelier JM, Hue I, Demnerova K, Fédérighi M, Prévost H, Drider D Antimicrob Agents Chemother. 54:

42 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Résultats Groupes 1-5 / (Post- challenge test) 3.23 ±1.881/5 (20)2 / (30)1.5 x P40V ± 2.932/5 (40)2 / (30)1.5 x A22G ± 2.932/5 (40)2 / (30)1.5 x Q21S ± 2.461/5 (20)2 / (30)1.5 x W19F2 0.97±2.174/5 (80)2 / (30)1.5 x DvnRV411 nombre UFC (Log 10) /rate) Nombre des souris avec la culture négative / totale ; exprimé en (%) Quantité de peptide µg /temps (min) Quantité de L. monocytogenes EGDe introduite Nombre de souris infectées PeptideGroupe 6.25 ± 0.190/5 (0)1.5 x NC11 NC = contrôle négatif Rihakova J, Cappelier JM, Hue I, Demnerova K, Fédérighi M, Prévost H, Drider D Antimicrob Agents Chemother. 54:

43 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Résultats Groupes 6-10 / (Pré challenge test) 4.25 ±2.381/5 (20)2/ (15)1.5 x P40V ± 2.501/5 (20)2 / (15)1.5 x A22G ± 2.752/5 (40)2 / (15)1.5 x Q21S ± 2.321/5 (20)2 / (15)1.5 x W19F ±2.862/5 (40)2/ (15)1.5 x DvnR V41 6 nombre CFU (Log 10) /rate) Nombre des souris avec la culture négative / totale ; exprimé en (%) Quantité de peptide µg /temps (min) Quantité de L. monocytogenes EGDe introduite Nombre de souris infectée s PeptideGroupe 6.25 ± 0.190/5 (0)1.5 x CN11 CN = contrôle négatif Rihakova J, Cappelier JM, Hue I, Demnerova K, Fédérighi M, Prévost H, Drider D Antimicrob Agents Chemother. 54:

44 Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Publicité et bonnes œuvres Société Française des Peptides Antimicrobiens ou Third International Symposium on Food, Veterinary and Medical Applications (Lille 2012) ou Procaryotic antimicrobial peptides: from genes to biotechnologies. Edited by D. Drider and S. Rebuffat. (Springer, NY-USA. 2011)


Télécharger ppt "Cofinancé avec lappui de lUnion européenne FEDER Programme Espace Atlantique « Investir dans notre futur commun » Djamel Drider – Ph.D Unité de Recherche."

Présentations similaires


Annonces Google