La présentation est en train de télécharger. S'il vous plaît, attendez

La présentation est en train de télécharger. S'il vous plaît, attendez

Bioinformatique ABI-1001 2 ième partie: La Bioinformatique Structurale La Bioinformatique Structurale 2 ième partie: La Bioinformatique Structurale La.

Présentations similaires


Présentation au sujet: "Bioinformatique ABI-1001 2 ième partie: La Bioinformatique Structurale La Bioinformatique Structurale 2 ième partie: La Bioinformatique Structurale La."— Transcription de la présentation:

1 Bioinformatique ABI ième partie: La Bioinformatique Structurale La Bioinformatique Structurale 2 ième partie: La Bioinformatique Structurale La Bioinformatique Structurale

2 Avant-propos… La bioinformatique structurale est devenue une nécessité, compte tenu de la croissance exponentielle des données génomiques.La bioinformatique structurale est devenue une nécessité, compte tenu de la croissance exponentielle des données génomiques. –22 millions de séquences dans plus de espèces (GenBank). –Double de volume à tous les 15 mois –Un peu moins de structures connues dans PDB. –Chaque structure ~25000$ La bioinformatique structurale est devenue une nécessité, compte tenu de la croissance exponentielle des données génomiques.La bioinformatique structurale est devenue une nécessité, compte tenu de la croissance exponentielle des données génomiques. –22 millions de séquences dans plus de espèces (GenBank). –Double de volume à tous les 15 mois –Un peu moins de structures connues dans PDB. –Chaque structure ~25000$

3 Importance de la structure 3D Classification structurale et élaboration de bibliothèque protéomique.Classification structurale et élaboration de bibliothèque protéomique. Comparaisons de structures Fonction.Comparaisons de structures Fonction. Alignements structuraux mieux conservés que la séquence évolution.Alignements structuraux mieux conservés que la séquence évolution. Ingénierie et modélisation des protéines recherche de nouveaux médicaments (drug design) et de mutants spécifiques.Ingénierie et modélisation des protéines recherche de nouveaux médicaments (drug design) et de mutants spécifiques. Classification structurale et élaboration de bibliothèque protéomique.Classification structurale et élaboration de bibliothèque protéomique. Comparaisons de structures Fonction.Comparaisons de structures Fonction. Alignements structuraux mieux conservés que la séquence évolution.Alignements structuraux mieux conservés que la séquence évolution. Ingénierie et modélisation des protéines recherche de nouveaux médicaments (drug design) et de mutants spécifiques.Ingénierie et modélisation des protéines recherche de nouveaux médicaments (drug design) et de mutants spécifiques.

4 Le dogme central de la biologie structurale La fonction dune protéine est tributaire de sa structure.La fonction dune protéine est tributaire de sa structure. –Activité enzymatique. a.a. du site catalytiquea.a. du site catalytique Identité du substratIdentité du substrat Cofacteur et site de régulationCofacteur et site de régulation –Rôle biologique et localisation cellulaire ou tissulaire. –Implication phénotypique et pathologique. La fonction dune protéine est tributaire de sa structure.La fonction dune protéine est tributaire de sa structure. –Activité enzymatique. a.a. du site catalytiquea.a. du site catalytique Identité du substratIdentité du substrat Cofacteur et site de régulationCofacteur et site de régulation –Rôle biologique et localisation cellulaire ou tissulaire. –Implication phénotypique et pathologique. Structure Gène (ADN) Fonction Phénotype, Pathologie… Phénotype, Pathologie…

5 Le génome: le Klondike…(Data Mining) Recherche de gènes ou de séquences similaires Recherche de gènes ou de séquences similaires Prédiction de structure et de fonction Prédiction de structure et de fonction Homologie comparative Reconnaissance de repliement protéique (Threading) Prédiction Ab initio

6 La bioinformatique structurale??? VisualisationVisualisation –Création de software pouvant traiter le plus dinformation structurale possible (ex. surface électrostatique, site fonctionnel, zone de variabilité génétique…). ClassificationClassification –Regroupement de structures similaires en famille, superfamille et subdivision. Classification selon certain domaines structuraux ou catalytiques (ex. SCOP, CATH). PrédictionPrédiction –Modélisation par homologie de séquence, technique de reconnaissance de repliement et prédiction Ab initio. SimulationSimulation –Utilisation de mécanique ou de dynamique moléculaire afin de déterminer la conformation énergétiquement favorable dune protéine. Arrimage moléculaire (docking). VisualisationVisualisation –Création de software pouvant traiter le plus dinformation structurale possible (ex. surface électrostatique, site fonctionnel, zone de variabilité génétique…). ClassificationClassification –Regroupement de structures similaires en famille, superfamille et subdivision. Classification selon certain domaines structuraux ou catalytiques (ex. SCOP, CATH). PrédictionPrédiction –Modélisation par homologie de séquence, technique de reconnaissance de repliement et prédiction Ab initio. SimulationSimulation –Utilisation de mécanique ou de dynamique moléculaire afin de déterminer la conformation énergétiquement favorable dune protéine. Arrimage moléculaire (docking).

7 Rappel sur la structure des protéines Structure primaire:Structure primaire: –lordre des a.a. le long de la chaîne polypeptidique, i.e. la séquence. Structure secondaire:Structure secondaire: –lorganisation locale du squelette de la protéine; hélice, feuillet, les tours et les boucles. Structure tertiaire:Structure tertiaire: –assemblage spatial des éléments de structures secondaires. Structure quaternaire:Structure quaternaire: –formation dun complexe multimèrique de protéines. Structure primaire:Structure primaire: –lordre des a.a. le long de la chaîne polypeptidique, i.e. la séquence. Structure secondaire:Structure secondaire: –lorganisation locale du squelette de la protéine; hélice, feuillet, les tours et les boucles. Structure tertiaire:Structure tertiaire: –assemblage spatial des éléments de structures secondaires. Structure quaternaire:Structure quaternaire: –formation dun complexe multimèrique de protéines. CESTLALIGNEMENTDESAA

8 Visualisation: format de fichier Il existe plusieurs formats de données et de protocoles pour représenter la structure des macromolécules.Il existe plusieurs formats de données et de protocoles pour représenter la structure des macromolécules. –PDB(Protein Data Bank), mmCIF (macromolecular Crystallographic Information File), XML (extensible markup language), DTD (Document Type Definition)… De par sa simplicité et son efficacité à représenter des structures tridimensionnelles, le format PDB (Protein Data Bank) reste tout de même le format le plus supporté par les programmes de visualisation et déchange de données structurales.De par sa simplicité et son efficacité à représenter des structures tridimensionnelles, le format PDB (Protein Data Bank) reste tout de même le format le plus supporté par les programmes de visualisation et déchange de données structurales. Il existe plusieurs formats de données et de protocoles pour représenter la structure des macromolécules.Il existe plusieurs formats de données et de protocoles pour représenter la structure des macromolécules. –PDB(Protein Data Bank), mmCIF (macromolecular Crystallographic Information File), XML (extensible markup language), DTD (Document Type Definition)… De par sa simplicité et son efficacité à représenter des structures tridimensionnelles, le format PDB (Protein Data Bank) reste tout de même le format le plus supporté par les programmes de visualisation et déchange de données structurales.De par sa simplicité et son efficacité à représenter des structures tridimensionnelles, le format PDB (Protein Data Bank) reste tout de même le format le plus supporté par les programmes de visualisation et déchange de données structurales.

9 Le format PDB Contient:Contient: –Les coordonnées atomiques, –Certaines spécificités chimiques et biochimiques, –Des détails expérimentaux, –Des informations structurales comme la reconnaissance de structures secondaires, –Les liaisons hydrogènes, –Lassemblage biologique et les sites actifs. Contient:Contient: –Les coordonnées atomiques, –Certaines spécificités chimiques et biochimiques, –Des détails expérimentaux, –Des informations structurales comme la reconnaissance de structures secondaires, –Les liaisons hydrogènes, –Lassemblage biologique et les sites actifs.

10 Le format PDB HEADER ELECTRON TRANSPORT 19-MAR-90 2TRX 2TRXA 1 COMPND THIOREDOXIN 2TRXA 2 SOURCE (ESCHERICHIA $COLI) 2TRX 4 AUTHOR S.K.KATTI,D.M.LE*MASTER,H.EKLUND 2TRX 5 REVDAT 2 15-JAN-93 2TRXA 1 HEADER COMPND 2TRXA 3 REVDAT 1 15-OCT-91 2TRX 0 2TRX 6 JRNL AUTH S.K.KATTI,D.M.LE*MASTER,H.EKLUND 2TRX 7 JRNL TITL CRYSTAL STRUCTURE OF THIOREDOXIN FROM ESCHERICHIA 2TRX 8 JRNL TITL 2 $COLI AT 1.68 ANGSTROMS RESOLUTION 2TRX 9 JRNL REF J.MOL.BIOL. V TRX 10 JRNL REFN ASTM JMOBAK UK ISSN TRX 11 REMARK 1 HEADER – Fonction, date, code daccès PDB. CMPND – Nom de la protéine ou de la macromolécule. SOURCE – Origine ou source de la molécule (espèce). REVDAT – Date de révision. JRNL – Première référence décrivant la structure (auteur, journal…). REMARK – Des commentaires de lauteur sur la structure. HEADER – Fonction, date, code daccès PDB. CMPND – Nom de la protéine ou de la macromolécule. SOURCE – Origine ou source de la molécule (espèce). REVDAT – Date de révision. JRNL – Première référence décrivant la structure (auteur, journal…). REMARK – Des commentaires de lauteur sur la structure.

11 SEQRES – Séquence de la protéine par code à trois lettres. HET – Le nom des hétéroatomes. SEQRES – Séquence de la protéine par code à trois lettres. HET – Le nom des hétéroatomes. Le format PDB REMARK 6 CORRECTION. CORRECT CLASSIFICATION ON HEADER RECORD AND 2TRXA 5 REMARK 6 REMOVE E.C. CODE. 15-JAN-93. 2TRXA 6 SEQRES 1 A 108 SER ASP LYS ILE ILE HIS LEU THR ASP ASP SER PHE ASP 2TRX 74 SEQRES 2 A 108 THR ASP VAL LEU LYS ALA ASP GLY ALA ILE LEU VAL ASP 2TRX 75 SEQRES 3 A 108 PHE TRP ALA GLU TRP CYS GLY PRO CYS LYS MET ILE ALA 2TRX 76 SEQRES 4 A 108 PRO ILE LEU ASP GLU ILE ALA ASP GLU TYR GLN GLY LYS 2TRX 77 SEQRES 5 A 108 LEU THR VAL ALA LYS LEU ASN ILE ASP GLN ASN PRO GLY 2TRX 78 SEQRES 6 A 108 THR ALA PRO LYS TYR GLY ILE ARG GLY ILE PRO THR LEU 2TRX 79 SEQRES 7 A 108 LEU LEU PHE LYS ASN GLY GLU VAL ALA ALA THR LYS VAL 2TRX 80 SEQRES 8 A 108 GLY ALA LEU SER LYS GLY GLN LEU LYS GLU PHE LEU ASP 2TRX 81 SEQRES 9 A 108 ALA ASN LEU ALA 2TRX 82 HET CU COPPER ++ ION 2TRX 100 HET CU COPPER ++ ION 2TRX 101 HET MPD METHYL-2,4-PENTANEDIOL 2TRX 102 HET MPD METHYL-2,4-PENTANEDIOL 2TRX 103

12 Le format PDB FORMUL 3 CU 2(CU1 ++) 2TRX 110 FORMUL 4 MPD 8(C6 H14 O2) 2TRX 111 FORMUL 5 HOH *140(H2 O1) 2TRX 112 HELIX 1 A1A SER A 11 LEU A 17 1 DISORDERED IN MOLECULE B 2TRX 113 HELIX 2 A2A CYS A 32 TYR A 49 1 BENT BY 30 DEGREES AT RES 39 2TRX 114 HELIX 3 A3A ASN A 59 ASN A TRX 115 HELIX 4 31A THR A 66 TYR A 70 5 DISTORTED H-BONDING C-TERMINS 2TRX 116 HELIX 5 A4A SER A 95 LEU A TRX 117 SHEET 1 B1A 5 LYS A 3 THR A 8 0 2TRX 123 SHEET 2 B1A 5 LEU A 53 ASN A 59 1 O VAL A 55 N ILE A 5 2TRX 124 SHEET 3 B1A 5 GLY A 21 TRP A 28 1 N TRP A 28 O LEU A 58 2TRX 125 SHEET 4 B1A 5 PRO A 76 LYS A O THR A 77 N PHE A 27 2TRX 126 SHEET 5 B1A 5 VAL A 86 GLY A N GLY A 92 O LYS A 82 2TRX 127 SSBOND 1 CYS A 32 CYS A 35 2TRX 143 FORMUL – Formule chimique des hétéroatomes. HELIX – Localisation des hélices tel quindiquée par lauteur. SHEET – Localisation des feuillets tel quindiquée par lauteur. SSBOND – Localisation et existence de ponts disulfures. FORMUL – Formule chimique des hétéroatomes. HELIX – Localisation des hélices tel quindiquée par lauteur. SHEET – Localisation des feuillets tel quindiquée par lauteur. SSBOND – Localisation et existence de ponts disulfures.

13 Le format PDB ORIGX TRX 146 ORIGX TRX 147 ORIGX TRX 148 SCALE TRX 149 SCALE TRX 150 SCALE TRX 151 ATOM 1 N SER A TRX 152 ATOM 2 CA SER A TRX 153 ATOM 3 C SER A TRX 154 ATOM 4 O SER A TRX 155 ATOM 5 CB SER A TRX 156 ATOM 6 OG SER A TRX 157 ATOM 7 N ASP A TRX 158 ATOM 8 CA ASP A TRX 159 ATOM 9 C ASP A TRX 160 ATOM 10 O ASP A TRX 161 ORIGXn – Facteurs de transformation en coordonnées orthogonales. SCALEn – Facteurs pour transformer en coor. fractionnaires du cristal. ATOM – Coordonnées atomiques de la molécule. ORIGXn – Facteurs de transformation en coordonnées orthogonales. SCALEn – Facteurs pour transformer en coor. fractionnaires du cristal. ATOM – Coordonnées atomiques de la molécule.

14 Le format PDB ATOM 1 N SER A TRX 152 ATOM 2 CA SER A TRX 153 ATOM 3 C SER A TRX 154 ATOM 4 O SER A TRX 155 ATOM 5 CB SER A TRX 156 ATOM 6 OG SER A TRX 157 ATOM 7 N ASP A TRX 158 ATOM 8 CA ASP A TRX 159 ATOM 9 C ASP A TRX 160 ATOM 10 O ASP A TRX 161 # de latome Nom de latome latome Nom du résidu résidu Nom du résidu résidu # du résidu Coord. en X (Å) Coord. en Y (Å) Coord. en Z (Å) OccupantOccupant B-factor (nm 2 ) (facteur isotropique) B-factor (nm 2 ) (facteur isotropique) Dautres informations disponibles à:

15 The Protein Data Bank 1R6T

16 The Protein Data Bank

17

18 {

19

20

21

22 The Protein Data Bank/Sting Millenium

23 The Protein Data Bank/SwissProt

24 The Protein Data Bank

25

26 Dautres bases de données structurales… Biological Macromolecule Crystallization Database and the NASA Archive for Protein Crystal Growth Data.Biological Macromolecule Crystallization Database and the NASA Archive for Protein Crystal Growth Data.Biological Macromolecule Crystallization Database and the NASA Archive for Protein Crystal Growth Data.Biological Macromolecule Crystallization Database and the NASA Archive for Protein Crystal Growth Data. –Contient les donn é es et les conditions de cristallisation. Archives de la NASA sur la cristallisation en apesanteur. Cambridge Structural Database (CSD)Cambridge Structural Database (CSD)Cambridge Structural Database (CSD)Cambridge Structural Database (CSD) –Structures de petites mol é cules organiques, 1D, 2D et 3D. The Molecular Modeling Database (MMDB)The Molecular Modeling Database (MMDB)The Molecular Modeling Database (MMDB)The Molecular Modeling Database (MMDB) –Liens vers la litt é rature, la s é quence et l information g é nomique. PQS Protein Quaternary StructurePQS Protein Quaternary StructurePQS Protein Quaternary StructurePQS Protein Quaternary Structure –Procure des renseignements sur la structure de l unit é biologique active d une prot é ine. ReliBase:protein-ligand databasesReliBase:protein-ligand databasesReliBase:protein-ligand databasesReliBase:protein-ligand databases –Contient les informations sur la liaison des ligands (inhibiteurs, cofacteurs, métaux lourds, ions…) Biological Macromolecule Crystallization Database and the NASA Archive for Protein Crystal Growth Data.Biological Macromolecule Crystallization Database and the NASA Archive for Protein Crystal Growth Data.Biological Macromolecule Crystallization Database and the NASA Archive for Protein Crystal Growth Data.Biological Macromolecule Crystallization Database and the NASA Archive for Protein Crystal Growth Data. –Contient les donn é es et les conditions de cristallisation. Archives de la NASA sur la cristallisation en apesanteur. Cambridge Structural Database (CSD)Cambridge Structural Database (CSD)Cambridge Structural Database (CSD)Cambridge Structural Database (CSD) –Structures de petites mol é cules organiques, 1D, 2D et 3D. The Molecular Modeling Database (MMDB)The Molecular Modeling Database (MMDB)The Molecular Modeling Database (MMDB)The Molecular Modeling Database (MMDB) –Liens vers la litt é rature, la s é quence et l information g é nomique. PQS Protein Quaternary StructurePQS Protein Quaternary StructurePQS Protein Quaternary StructurePQS Protein Quaternary Structure –Procure des renseignements sur la structure de l unit é biologique active d une prot é ine. ReliBase:protein-ligand databasesReliBase:protein-ligand databasesReliBase:protein-ligand databasesReliBase:protein-ligand databases –Contient les informations sur la liaison des ligands (inhibiteurs, cofacteurs, métaux lourds, ions…)

27 Dautres bases de données structurales… Base de données sur certaines familles de protéines:Base de données sur certaines familles de protéines: –The Protein Kinase Resource. The Protein Kinase Resource.The Protein Kinase Resource. –Metalloproteins. Metalloproteins. –Membrane Proteins of known 3D structure Membrane Proteins of known 3D structureMembrane Proteins of known 3D structure Database of Macromolecular Movements.Database of Macromolecular Movements.Database of Macromolecular Movements.Database of Macromolecular Movements. –Animations(*.gif) et films(*.mpg) qui décrivent le mouvement connu de certaine protéine. Assez spectaculaire parfois… quand on est conscient de la beauté de la chose. Base de données sur certaines familles de protéines:Base de données sur certaines familles de protéines: –The Protein Kinase Resource. The Protein Kinase Resource.The Protein Kinase Resource. –Metalloproteins. Metalloproteins. –Membrane Proteins of known 3D structure Membrane Proteins of known 3D structureMembrane Proteins of known 3D structure Database of Macromolecular Movements.Database of Macromolecular Movements.Database of Macromolecular Movements.Database of Macromolecular Movements. –Animations(*.gif) et films(*.mpg) qui décrivent le mouvement connu de certaine protéine. Assez spectaculaire parfois… quand on est conscient de la beauté de la chose. Une Topoisomérase en plein travail… ATPase Ca +2

28 Et si on intégrait tout…

29

30

31

32

33 Visualisation moléculaire…les jouets! La plupart des programmes de visualisation permettent de visionner des macromolécules comme les protéines et lADN/ARN selon divers formats de fichier. Certains possèdent des caractéristiques spécifiques (affichage des orbitales moléculaires, densités délectrons…), dautres sutilisent comme plug-in de browser web.La plupart des programmes de visualisation permettent de visionner des macromolécules comme les protéines et lADN/ARN selon divers formats de fichier. Certains possèdent des caractéristiques spécifiques (affichage des orbitales moléculaires, densités délectrons…), dautres sutilisent comme plug-in de browser web. Pour une liste exhaustive:Pour une liste exhaustive: La plupart des programmes de visualisation permettent de visionner des macromolécules comme les protéines et lADN/ARN selon divers formats de fichier. Certains possèdent des caractéristiques spécifiques (affichage des orbitales moléculaires, densités délectrons…), dautres sutilisent comme plug-in de browser web.La plupart des programmes de visualisation permettent de visionner des macromolécules comme les protéines et lADN/ARN selon divers formats de fichier. Certains possèdent des caractéristiques spécifiques (affichage des orbitales moléculaires, densités délectrons…), dautres sutilisent comme plug-in de browser web. Pour une liste exhaustive:Pour une liste exhaustive:

34 Visualisation moléculaire…les jouets! CapacitésCommentairesAvantagesDésavantages Rasmol* Présentation Présentation Interrogations structurales Interrogations structurales Léger et vraiment puissant Léger et vraiment puissant Rapide et Gratuit Rapide et Gratuit Ligne de commande puissante Ligne de commande puissante Grand éventail de représentation graphique Grand éventail de représentation graphique 1 seule structure à la fois 1 seule structure à la fois Graphisme laid, Graphisme laid, Mal adapté au Web Mal adapté au Web PyMol Présentation Présentation Puissant Puissant Entrées via l'interface graphique ou ligne de commande Entrées via l'interface graphique ou ligne de commande Grand éventail de représentation graphique Grand éventail de représentation graphique Fonctionne sur toute les plates-formes Fonctionne sur toute les plates-formes Difficile à maîtriser Difficile à maîtriser Exigeant du point de vue CPU et mémoire Exigeant du point de vue CPU et mémoire QuickPDB Requête de structure Requête de structure Interface simple et outil d'affichage de séquence Interface simple et outil d'affichage de séquence Permet de considérer la séquence et la structure simultanément Permet de considérer la séquence et la structure simultanément Interface Web, Structure Java Interface Web, Structure Java Très Basic Très Basic VMD* Analyse structurale et présentation Analyse structurale et présentation Beaucoup d'outil pour la dynamique moléculaire et la modélisation Beaucoup d'outil pour la dynamique moléculaire et la modélisation Souris et/ou un scripte de langage puissant Souris et/ou un scripte de langage puissant Facile à utiliser Facile à utiliser Toujours sous développement Toujours sous développement Exigeant du point de vue CPU et mémoire Exigeant du point de vue CPU et mémoire Surtout orienté dynamique moléculaire. Surtout orienté dynamique moléculaire. Cn3D* Présentation Présentation Interrogations structurales Interrogations structurales Léger et vraiment puissant Léger et vraiment puissant Beau Graphisme Beau Graphisme Rapide et Gratuit Rapide et Gratuit Grand éventail de représentation graphique Grand éventail de représentation graphique Outil de séquence Outil de séquence 1 seule structure à la fois 1 seule structure à la fois Ne supporte pas le format PDB Ne supporte pas le format PDB Molmol Analyse structurale et présentation Analyse structurale et présentation Puissant Puissant Beaucoup doutil danalyse Beaucoup doutil danalyse Beau graphisme Beau graphisme Gamme étendue d'outil danalyse Gamme étendue d'outil danalyse Peu intuitif Peu intuitif

35 Visualisation moléculaire…les jouets! CapacitésCommentairesAvantagesDésavantages Biodesigner Présentation Présentation Interrogations et analyses structurales Interrogations et analyses structurales Puissant Puissant Outils dalignement, de superposition et dédition Outils dalignement, de superposition et dédition Plusieurs structures à la fois Plusieurs structures à la fois Grand éventail de représentation graphique Grand éventail de représentation graphique Exigeant du point de vue CPU et mémoire Exigeant du point de vue CPU et mémoire Pas pour débutant Pas pour débutant WebLab Viewer Présentation Présentation Beau graphisme Beau graphisme Facile dutilisation Facile dutilisation Grand éventail de représentation graphique Grand éventail de représentation graphique Fonctionne sur toute les plates-formes Fonctionne sur toute les plates-formes Outil de visualisation seulement Outil de visualisation seulement Rastop* Rasmol amélioré Rasmol amélioré Plus puissant que Rasmol Plus puissant que Rasmol Nouvelles fonctions Nouvelles fonctions Interface graphique améliorée Interface graphique améliorée Plate-forme Windows seulement Plate-forme Windows seulement Chime/ Protein Explorer* Présentation Présentation Plug-in Web Plug-in Web Souris et/ou un scripte de langage puissant Souris et/ou un scripte de langage puissant Facile à utiliser Facile à utiliser Toujours sous développement Toujours sous développement Peu versatile Peu versatile Peu/pas doutils danalyse Peu/pas doutils danalyse Molecular Operating Environment (MOE)*/ Insight (Merck) Multiple capacité danalyses et dinterrogations structurales Multiple capacité danalyses et dinterrogations structurales Simulation et Modélisation Simulation et Modélisation Présentation et Visualisation Présentation et Visualisation Très puissant Très puissant Beaucoup doutils danalyses Beaucoup doutils danalyses Grand éventail de représentation graphique Grand éventail de représentation graphique Gamme étendue d'outils danalyses Gamme étendue d'outils danalyses Homologie et superposition structurale Homologie et superposition structurale Toujours sous développement Toujours sous développement Licence dispendieuse $$$ Licence dispendieuse $$$

36 Exemple… MPNSEPASLLELFNSIATQGELVRSLKAGNA SKDEIDSAVKXLVSLKXSYKAAAGEDYKAD CPPGNPAPTSNHGPDATEAEEDFVDPWTV QTSSAKGIDYDKLIVRFGSSKIDKELINRIER ATGQRPHHFLRRGIFFSHRDXNQVLDAYEN KKPFYLYTGRGPSSEAXHVGHLIPFIFTKWL QDVFNVPLVIQXTDDEKYLWKDLTLDQAYG DAVENAKDIIACGFDINKTFIFSDLDYXGXSS GFYKNVVKIQKHVTFNQVKGIFGFTDSDCIG KISFPAIQAAPSFSNSFPQIFRDRTDIQCLIP CAIDQDPYFRXTRDVAPRIGYPKPALLHSTF FPALQGAQTKXSASDPNSSIFLTDTAKQIKT KVNKHAFSGGRDTIEEHRQFGGNCDVDVS FXYLTFFLEDDDKLEQIRKDYTSGAXLTGEL KKALIEVLQPLIAEHQARRKEVTDEIVKEFXT PRKLAAALEHHHHHHMPNSEPASLLELFNSIATQGELVRSLKAGNA SKDEIDSAVKXLVSLKXSYKAAAGEDYKAD CPPGNPAPTSNHGPDATEAEEDFVDPWTV QTSSAKGIDYDKLIVRFGSSKIDKELINRIER ATGQRPHHFLRRGIFFSHRDXNQVLDAYEN KKPFYLYTGRGPSSEAXHVGHLIPFIFTKWL QDVFNVPLVIQXTDDEKYLWKDLTLDQAYG DAVENAKDIIACGFDINKTFIFSDLDYXGXSS GFYKNVVKIQKHVTFNQVKGIFGFTDSDCIG KISFPAIQAAPSFSNSFPQIFRDRTDIQCLIP CAIDQDPYFRXTRDVAPRIGYPKPALLHSTF FPALQGAQTKXSASDPNSSIFLTDTAKQIKT KVNKHAFSGGRDTIEEHRQFGGNCDVDVS FXYLTFFLEDDDKLEQIRKDYTSGAXLTGEL KKALIEVLQPLIAEHQARRKEVTDEIVKEFXT PRKLAAALEHHHHHH Database: PDB Database: PDB No CDsearch No CDsearch MPNSEPASLLELFNSIATQGELVRSLKAGNA SKDEIDSAVKXLVSLKXSYKAAAGEDYKAD CPPGNPAPTSNHGPDATEAEEDFVDPWTV QTSSAKGIDYDKLIVRFGSSKIDKELINRIER ATGQRPHHFLRRGIFFSHRDXNQVLDAYEN KKPFYLYTGRGPSSEAXHVGHLIPFIFTKWL QDVFNVPLVIQXTDDEKYLWKDLTLDQAYG DAVENAKDIIACGFDINKTFIFSDLDYXGXSS GFYKNVVKIQKHVTFNQVKGIFGFTDSDCIG KISFPAIQAAPSFSNSFPQIFRDRTDIQCLIP CAIDQDPYFRXTRDVAPRIGYPKPALLHSTF FPALQGAQTKXSASDPNSSIFLTDTAKQIKT KVNKHAFSGGRDTIEEHRQFGGNCDVDVS FXYLTFFLEDDDKLEQIRKDYTSGAXLTGEL KKALIEVLQPLIAEHQARRKEVTDEIVKEFXT PRKLAAALEHHHHHHMPNSEPASLLELFNSIATQGELVRSLKAGNA SKDEIDSAVKXLVSLKXSYKAAAGEDYKAD CPPGNPAPTSNHGPDATEAEEDFVDPWTV QTSSAKGIDYDKLIVRFGSSKIDKELINRIER ATGQRPHHFLRRGIFFSHRDXNQVLDAYEN KKPFYLYTGRGPSSEAXHVGHLIPFIFTKWL QDVFNVPLVIQXTDDEKYLWKDLTLDQAYG DAVENAKDIIACGFDINKTFIFSDLDYXGXSS GFYKNVVKIQKHVTFNQVKGIFGFTDSDCIG KISFPAIQAAPSFSNSFPQIFRDRTDIQCLIP CAIDQDPYFRXTRDVAPRIGYPKPALLHSTF FPALQGAQTKXSASDPNSSIFLTDTAKQIKT KVNKHAFSGGRDTIEEHRQFGGNCDVDVS FXYLTFFLEDDDKLEQIRKDYTSGAXLTGEL KKALIEVLQPLIAEHQARRKEVTDEIVKEFXT PRKLAAALEHHHHHH Database: PDB Database: PDB No CDsearch No CDsearch blastpblastp

37 Exemple… Protein Data Bank Pas nécessaire

38 Exemple… Le > Le < Lien vers la structure Identité (similitude)

39 Exemple… Afficher la structure avec Cn3D Choisir une chaîne

40 Enfin!

41 Quelques tutoriaux! Visual Molecular Dynamics (VMD)Visual Molecular Dynamics (VMD) –http://www.ks.uiuc.edu/Research/vmd/current/tutorial/html/node2.html Cn3DCn3D –http://www.ncbi.nlm.nih.gov/Structure/CN3D/cn3dtutP3.shtml Chime/ Protein ExplorerChime/ Protein Explorer –http://molvis.sdsc.edu/pe_alpha/protexpl/pe_tut.htm Visual Molecular Dynamics (VMD)Visual Molecular Dynamics (VMD) –http://www.ks.uiuc.edu/Research/vmd/current/tutorial/html/node2.html Cn3DCn3D –http://www.ncbi.nlm.nih.gov/Structure/CN3D/cn3dtutP3.shtml Chime/ Protein ExplorerChime/ Protein Explorer –http://molvis.sdsc.edu/pe_alpha/protexpl/pe_tut.htm

42 À suivre…après la pause! Caféine


Télécharger ppt "Bioinformatique ABI-1001 2 ième partie: La Bioinformatique Structurale La Bioinformatique Structurale 2 ième partie: La Bioinformatique Structurale La."

Présentations similaires


Annonces Google