La présentation est en train de télécharger. S'il vous plaît, attendez

La présentation est en train de télécharger. S'il vous plaît, attendez

Les nouvelles preuves de l’évolution: y accéder en classe PO 422

Présentations similaires


Présentation au sujet: "Les nouvelles preuves de l’évolution: y accéder en classe PO 422"— Transcription de la présentation:

1 Les nouvelles preuves de l’évolution: y accéder en classe PO 422
Phylogénétique Novembre 2009

2 Etude des relations de parenté entre espèces.
Phylogénie Etude des relations de parenté entre espèces. Une analyse phylogénétique permet d’estimer (modéliser) les relations évolutives qui existent entre les espèces grâce à un arbre: qui a un ancêtre commun - qui est le cousin de qui ? Phylogénétique Novembre 2009

3 Phylogénétique Novembre 2009

4 Il est possible de construire un arbre phylogénétique à partir de différents types de données:
Les données morphologiques (écailles ou plumes, présence de certains os du crâne, forme des feuilles…). Il existe quelques centaines de caractères définis dans ce but par les spécialistes. Les caractères physiologiques (température corporelle…) Phylogénétique Novembre 2009

5 Phylogénétique Novembre 2009

6 Les caractères physiologiques (température corporelle…) Mais aussi….
Il est possible de construire un arbre phylogénétique à partir de différents types de données: les données morphologiques (écailles ou plumes, présence de certains os du crâne,, forme des feuilles…). Il existe quelques centaines de caractères définis dans ce but par les spécialistes. Les caractères physiologiques (température corporelle…) Mais aussi…. L’ordre des gènes (par exemple sur l’ADN des mitochondries) les données moléculaires (séquences d’ADN ou de protéines). Des mutations modifient les séquences de l’ADN et par conséquent des protéines au cours de l’évolution. toutes les données existantes….(défi scientifique !) Phylogénétique Novembre 2009

7 Cytochrome C Phylogénétique Novembre 2009
Phylogénétique Novembre 2009

8 Comment construire des arbres phylogénétiques sur la base des séquences des protéines…
Novembre 2009

9 ? Actin-related protein 2 Les différentes espèces sont:
ARP2_A MESAP---IVLDNGTGFVKVGYAKDNFPRFQFPSIVGRPILRAEEKTGNVQIKDVMVGDE ARP2_B MDSQGRKVIVVDNGTGFVKCGYAGTNFPAHIFPSMVGRPIVRSTQRVGNIEIKDLMVGEE ARP2_C MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE ARP2_D MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE ARP2_E MDSKGRNVIVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDE *:* :* ******** *** *** . **::****::*: . *::::**:***:* Les différentes espèces sont: Caenorhabditis briggsae Drosophila melanogaster Homo sapiens Mus musculus Schizosaccharomyces pombe Quelle séquence ‘appartient’ à quelle espèce ? ? Phylogénétique Novembre 2009

10 ARP2_A MESAP---IVLDNGTGFVKVGYAKDNFPRFQFPSIVGRPILRAEEKTGNVQIKDVMVGDE
ARP2_B MDSQGRKVIVVDNGTGFVKCGYAGTNFPAHIFPSMVGRPIVRSTQRVGNIEIKDLMVGEE *:* **:******** *** *** . ***:*****:*: :..**::***:***:* ARP2_C MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE ********:* *************:*** ****::*****:*** .************:* ARP2_D MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE ************************************************************ ARP2_E MDSKGRNVIVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDE ***:**:*:******************* ****::****:**:..*:*:**:******** *:* :* ******** *** .*** . **::*****:*: *.**::***:***** Phylogénétique Novembre 2009

11 PhiloPhylo ‘kit tout en 1’, mais avec un choix limité de protéines au départ…
banques de données de protéines (encyclopédie) contenant des informations biologiques et les séquences en acides aminés. Phylogénétique Novembre 2009

12 Le principe 1. Sélection: set de séquences de protéines ‘homologues’
2. Comparaison: alignement multiple 3. Construction de l’arbre: ‘calculer les différences’ Phylogénétique Novembre 2009

13 Le principe Sélection: set de séquences de protéines ‘homologues’
Comparaison: alignement multiple Construction de l’arbre: ‘calculer les différences’ Phylogénétique Novembre 2009

14 PhiloPhylo Phylogénétique Novembre 2009

15 www.uniprot.org ‘query’ par nom de protéines ou nom de gènes Blast
Utiliser Exemples: Blast Utiliser ou le Phylogénétique Novembre 2009

16 Scénario 5: www.uniprot.org
Phylogénétique Novembre 2009

17 www.uniprot.org (query ‘insulin’)
Phylogénétique Novembre 2009

18 Protein and gene nameS www.uniprot.org/ query FOLH1 Phylogénétique
Novembre 2009

19 Liste de protéines ‘candidats’ http://education. expasy
Phylogénétique Novembre 2009

20 Le principe Sélection: set de séquences de protéines ‘homologues’
Comparaison: alignement multiple Construction de l’arbre: ‘calculer les différences’ Phylogénétique Novembre 2009

21 PhiloPhylo Phylogénétique Novembre 2009

22 www.uniprot.org (query ‘insulin’, align)
Alignement multiple des séquences en acides aminés de l’insuline de différentes espèces (query ‘insulin’, align) Phylogénétique Novembre 2009

23 Phylogénétique Novembre 2009

24 Les mutations dans l’ADN peuvent être dûes à
Des erreurs lors de la réplication de l’ADN Des agents chimiques ou physiques (fumée de cigarette, UV,…) Des virus Les conséquences des mutations peuvent être des changements ‘mineurs’ (changement d’un acide aminé pour un autre) ou majeurs (duplication de gènes, délétion d’un bout de chromosomes, …) Chez les mammifères, à chaque génération, il se produit en moyenne quelques dizaines de mutations dans le génome de chaque individu. Si ces mutations se trouvent dans l’ADN des cellules sexuelles, elles seront transmises à la descendance. La dérive génétique (‘genetic drift’) et/ou la sélection naturelle (favorisant la sélection des individus avec des mutations qui augmentent les chances de reproduction et de survie dans un environnement donné) fixeront les mutations dans une population puis une espèce donnée. Phylogénétique Novembre 2009

25 http://www3. interscience. wiley
(i) FR1 The FRIGIDA (FR1) gene has been shown to be a major determinant of flowering time in Arabidopsis thaliana. A majority of early-flowering ecotypes shows one or two deletions that generate a frameshift in the FR1 open reading frame (ORF), suggesting that this phenotype has arisen at least twice. Le Corre, Roux & Reboud (2002) performed a population analysis on different ecotypes and confirmed that the loss of function mutations was associated with an early-flowering phenotype, these gene inactivations systematically evolved in a non-neutral fashion. Moreover, they confirmed that the gene inactivation was phenotypically linked to an early flowering ecotype adaptated to cold environments (Johanson et al., 2000; Le Corre et al., 2002). This represents a strong indication that environmental change has driven this genetic change. (ii) CCR5 This primate transmembrane receptor is a cellular gateway for the entry of HIV-1 and all strains of SIV. Human homozygotes for the CCR5 null allele which has a 32 base pair (bp) deletion are highly resistant to HIV-1 infection. Another null allele (24 bp deletion) of CCR5 has convergently evolved in sooty mangabeys (Cercocebus atys), a natural host of SIV. The occurrence of the mangabey null allele at an appreciable frequency (around 4%) could be explained by positive selection; null homozygotes are protected from SIV infection because the encoded protein is not transported to the cell surface (Palacios et al., 1998). The null allele has been shown to be positively selected in humans (Galvani & Novembre, 2005). However, the exact nature of the selective pressure involved in the origin of the CCR5-{delta} 32 allele and its high prevalence in European populations (approximately 10%) is unclear as the HIV epidemic in humans is much more recent than the age of the null allele (about 700 years). However, both HIV and poxviruses enter leukocytes using chemokine receptors; it is plausible that the loss of the CCR5 chemokine receptor originally conferred resistance against smallpox. This hypothesis is supported by a correlation between historical smallpox epidemics and allele geographic distribution (Galvani & Slatkin, 2003). Phylogénétique Novembre 2009

26 On ne peut pas ‘muter’ n’importe quoi….
Peptide signal Hélice alpha Hélice alpha Phylogénétique Novembre 2009

27 Propriétés physico-chimiques des différents acides aminés
Tiny OH G P Hydrophilic A Aliphatic C Charged L S Hydrophobic I V T NH2 Y M F W R D N H E Q K Aromatic Positive Negative Phylogénétique Novembre 2009

28 www.uniprot.org (query ‘insulin’, align)
Phylogénétique Novembre 2009

29 Les gènes (et les protéines) évoluent à des vitesses différentes
L’histone H4 n’a accumulé que 2 mutations ‘conservatives’ en 1.5 milliard d’années Phylogénétique Novembre 2009

30 Les gènes (et les protéines) évoluent à des vitesses différentes
Une protéine qui a évolué extrêmement rapidement: l’involucrin (une protéine de la peau): 10 % de changements en l’espace de 4 millions d’années (séparation des chimpanzés et de l’homme) Phylogénétique Novembre 2009

31 Le principe Sélection: set de séquences de protéines ‘homologues’
Comparaison: alignement multiple Construction de l’arbre: ‘calculer les différences’ Phylogénétique Novembre 2009

32 Un arbre phylogénétique est un modèle qui décrit les relations entre des unités taxonomiques
Novembre 2009

33 Le résultat dépend de la protéine utilisée pour construire l’arbre…
Le résultat dépend de la protéine utilisée pour construire l’arbre….et le résultat ne correspond pas toujours à l’’arbre des espèces’… Phylogénétique Novembre 2009

34 Introduire le set de séquences sélectionnées à (format ‘fasta’) Utiliser les paramètres par défaut (‘one’ click) Phylogénétique Novembre 2009

35 Phylogénétique Novembre 2009

36 Cladogramme obtenu à partir de l’analyse phylogénétique de l’alignement multiple des séquences d’insuline Le résultat dépend de la protéine utilisée pour construire l’arbre….et le résultat ne correspond pas toujours à l’’arbre des espèces’… Phylogénétique Novembre 2009

37 Les différents types d’arbres (1)
Phylogénétique Novembre 2009

38 Arbres (cladogrammes)
F G A B C D E F G End nodes Internal nodes Branches Roots Phylogénétique Novembre 2009

39 Peabody museum exhibition on the Tree of Life http://www.peabody.yale.edu/exhibits/treeoflife/
Phylogénétique Novembre 2009

40 Combien d’arbres différents ?

41 Les différents types d’arbres (2)
Phylogénétique Novembre 2009

42 Arbres phylogénétiques
Cladogramme Phylogramme Qui est le cousin de qui ? La longueur des branches est proportionnelle aux différences. Cette longueur n’est pas toujours facile à interpréter ! Elle dépend entre autre de la vitesse d’évolution…(nombres de variations par site dans un laps de temps donné)

43 - Qui est le cousin de qui ? Qui a un ancêtre commun ?
Exemple de cladogramme obtenu à partir de l’analyse bioinformatique de l’alignement multiple des séquences d’insuline - Qui est le cousin de qui ? Qui a un ancêtre commun ? Phylogénétique Novembre 2009

44 Echelle: ‘expected number of changes per site’
Exemple de phylogramme obtenu à partir de l’analyse bioinformatique de l’alignement multiple des séquences d’insuline - Quelle protéine a évolué plus rapidement ? Echelle: ‘expected number of changes per site’ Le temps qui s’écoule….

45 Exemple de phylogramme obtenu à partir de l’analyse bioinformatique de l’alignement multiple des séquences d’insuline L’insuline de la carpe a ‘évolué’ (moins de changements dans sa séquences en acides aminés) moins rapidement que l’insuline des autres espèces… Probabilité que l’arbre ait la bonne configuration à chaque embranchement (> 0.95: OK) Le temps qui s’écoule…. Phylogénétique Novembre 2009

46 Les embranchements Spéciation Duplication de gènes Phylogénétique
Novembre 2009

47 Spéciation et duplication de gène
Frog gene A speciation Human gene A Orthologs speciation Mouse gene A Gene duplication Paralogs Mouse gene B Homologs speciation Ancestral gene Human gene B Orthologs speciation Frog gene B Drosophila gene AB Phylogénétique Novembre 2009

48 Spéciation et duplication de gène
Duplication ins1 – ins 2 Spéciation rat - souris Phylogénétique Novembre 2009

49 "Ce qui n'est pas entouré d'incertitudes ne peut pas être la vérité » R. Feynmann
Phylogénétique Novembre 2009

50 A vous de jouer… Phylogénétique Novembre 2009

51 Ressources taxonomiques
Phylogénétique Novembre 2009

52 http://www.ncbi.nlm.nih.gov/guide/taxonomy/ Phylogénétique
Novembre 2009

53 Phylogénétique Novembre 2009

54 Animal Diversity Web (ADW) http://animaldiversity. ummz. umich
Phylogénétique Novembre 2009

55 Perspectives et applications
Phylogénétique Novembre 2009

56 Facteur d’élongation Les mitochondries et chloroplastes sont d’origine bactérienne ‘endosymbiotique’ Phylogénétique Novembre 2009

57 ~200 protéines universelles Arbre ‘global’ Applications
Autres projets ~200 protéines universelles Arbre ‘global’ Applications métagénomes (identifications de nouvelles espèces, de nouveaux gènes (20 mo), de nouveaux enzymes….) 1ml d’eau de mer: 1 million de bactéries et 10 million de virus (C.Venter). découvertes de nouvelles bactéries (la moitié de la biomasse) médecine: identification de nouveaux pathogènes. Phylogénétique Novembre 2009

58 Références http://www.unige.ch/presse/Campus/campus95.html
Phylogénétique Novembre 2009

59 Liste de gènes intéressants
‘Conceptual bases for quantifying the role of the environment on gene evolution: the participation of positive selection and neutral evolution’ Phylogénétique Novembre 2009

60 http://www3. interscience. wiley
(i) FR1 The FRIGIDA (FR1) gene has been shown to be a major determinant of flowering time in Arabidopsis thaliana. A majority of early-flowering ecotypes shows one or two deletions that generate a frameshift in the FR1 open reading frame (ORF), suggesting that this phenotype has arisen at least twice. Le Corre, Roux & Reboud (2002) performed a population analysis on different ecotypes and confirmed that the loss of function mutations was associated with an early-flowering phenotype, these gene inactivations systematically evolved in a non-neutral fashion. Moreover, they confirmed that the gene inactivation was phenotypically linked to an early flowering ecotype adaptated to cold environments (Johanson et al., 2000; Le Corre et al., 2002). This represents a strong indication that environmental change has driven this genetic change. (ii) CCR5 This primate transmembrane receptor is a cellular gateway for the entry of HIV-1 and all strains of SIV. Human homozygotes for the CCR5 null allele which has a 32 base pair (bp) deletion are highly resistant to HIV-1 infection. Another null allele (24 bp deletion) of CCR5 has convergently evolved in sooty mangabeys (Cercocebus atys), a natural host of SIV. The occurrence of the mangabey null allele at an appreciable frequency (around 4%) could be explained by positive selection; null homozygotes are protected from SIV infection because the encoded protein is not transported to the cell surface (Palacios et al., 1998). The null allele has been shown to be positively selected in humans (Galvani & Novembre, 2005). However, the exact nature of the selective pressure involved in the origin of the CCR5-{delta} 32 allele and its high prevalence in European populations (approximately 10%) is unclear as the HIV epidemic in humans is much more recent than the age of the null allele (about 700 years). However, both HIV and poxviruses enter leukocytes using chemokine receptors; it is plausible that the loss of the CCR5 chemokine receptor originally conferred resistance against smallpox. This hypothesis is supported by a correlation between historical smallpox epidemics and allele geographic distribution (Galvani & Slatkin, 2003). Phylogénétique Novembre 2009

61 Exemple de gènes / protéines
Phylogénétique Novembre 2009

62 Divers - Simulation par ordinateur: avec 2 mécanismes, le hasard et la sélection, l’informaticien Karl Sim a généré une complexité fascinante: Phylogénétique Novembre 2009

63 Phylogenetic servers http://www.phylogeny.fr/
Phylogénétique Novembre 2009

64 Un ancêtre commun Phylogénétique Novembre 2009

65 La construction d’arbre phylogénétique ne serait pas possible …
sans la notion d’ancêtre commun… Les espèces ne sont pas immuables, mais issues d’autres espèces et peuvent elles-mêmes donner naissance à de nouvelles. La sélection naturelle est opportuniste et ne poursuit aucun but à long terme. Jean-Baptiste de Lamarck et Charles Darwin Phylogénétique Novembre 2009

66 Cette notion d’ancêtre commun a été confirmée
par la découverte de l’ADN et du code génétique ‘quasi universel’* que se partagent tous les organismes vivants. *http://www.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi?mode=c par la découverte de gènes très conservés entre les espèces (exemples: gène ‘engrailed’, histone H4, ARN ribosomal) et de gènes ‘universels’ (~200). Phylogénétique Novembre 2009

67 Peabody museum exhibition on the Tree of Life http://www.peabody.yale.edu/exhibits/treeoflife/
Phylogénétique Novembre 2009

68 LUCA: Last Universal Common Ancestor
LUCA est la ‘racine’ de l’arbre de la vie, mais probablement pas le premier organisme unicellulaire vivant. Il devait être déjà complexe et donc le résultat d’un long processus d’évolution Phylogénétique Novembre 2009

69 Peabody museum exhibition on the Tree of Life http://www.peabody.yale.edu/exhibits/treeoflife/
Phylogénétique Novembre 2009

70 Phylogénétique Novembre 2009

71 Phylogénétique Novembre 2009


Télécharger ppt "Les nouvelles preuves de l’évolution: y accéder en classe PO 422"

Présentations similaires


Annonces Google