La présentation est en train de télécharger. S'il vous plaît, attendez

La présentation est en train de télécharger. S'il vous plaît, attendez

Novembre 2009Phylogénétique1 Les nouvelles preuves de lévolution: y accéder en classe PO 422.

Présentations similaires


Présentation au sujet: "Novembre 2009Phylogénétique1 Les nouvelles preuves de lévolution: y accéder en classe PO 422."— Transcription de la présentation:

1 Novembre 2009Phylogénétique1 Les nouvelles preuves de lévolution: y accéder en classe PO 422

2 Novembre 2009Phylogénétique2 Phylogénie Etude des relations de parenté entre espèces. Une analyse phylogénétique permet destimer (modéliser) les relations évolutives qui existent entre les espèces grâce à un arbre: qui a un ancêtre commun - qui est le cousin de qui ?

3 Novembre 2009Phylogénétique3

4 Novembre 2009Phylogénétique4 Il est possible de construire un arbre phylogénétique à partir de différents types de données: –Les données morphologiques (écailles ou plumes, présence de certains os du crâne, forme des feuilles…). Il existe quelques centaines de caractères définis dans ce but par les spécialistes. –Les caractères physiologiques (température corporelle…)

5 Novembre 2009Phylogénétique5

6 Novembre 2009Phylogénétique6 Il est possible de construire un arbre phylogénétique à partir de différents types de données: –les données morphologiques (écailles ou plumes, présence de certains os du crâne,, forme des feuilles…). Il existe quelques centaines de caractères définis dans ce but par les spécialistes. –Les caractères physiologiques (température corporelle…) Mais aussi…. –Lordre des gènes (par exemple sur lADN des mitochondries) –les données moléculaires (séquences dADN ou de protéines). Des mutations modifient les séquences de lADN et par conséquent des protéines au cours de lévolution. –toutes les données existantes….(défi scientifique !)

7 Novembre 2009Phylogénétique7 Cytochrome C

8 Novembre 2009Phylogénétique8 Comment construire des arbres phylogénétiques sur la base des séquences des protéines…

9 Novembre 2009Phylogénétique9 Actin-related protein 2 ARP2_A MESAP---IVLDNGTGFVKVGYAKDNFPRFQFPSIVGRPILRAEEKTGNVQIKDVMVGDE ARP2_B MDSQGRKVIVVDNGTGFVKCGYAGTNFPAHIFPSMVGRPIVRSTQRVGNIEIKDLMVGEE ARP2_C MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE ARP2_D MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE ARP2_E MDSKGRNVIVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDE *:* :* ******** *** ***. **::****::*:. *::::**:***:* Les différentes espèces sont: Caenorhabditis briggsae Drosophila melanogaster Homo sapiens Mus musculus Schizosaccharomyces pombe Quelle séquence appartient à quelle espèce ? ?

10 Novembre 2009Phylogénétique10 ARP2_A MESAP---IVLDNGTGFVKVGYAKDNFPRFQFPSIVGRPILRAEEKTGNVQIKDVMVGDE ARP2_B MDSQGRKVIVVDNGTGFVKCGYAGTNFPAHIFPSMVGRPIVRSTQRVGNIEIKDLMVGEE *:* **:******** *** ***. ***:*****:*: :..**::***:***:* ARP2_B MDSQGRKVIVVDNGTGFVKCGYAGTNFPAHIFPSMVGRPIVRSTQRVGNIEIKDLMVGEE ARP2_C MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE ********:* *************:*** ****::*****:***.************:* ARP2_C MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE ARP2_D MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE ************************************************************ ARP2_D MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE ARP2_E MDSKGRNVIVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDE ***:**:*:******************* ****::****:**:..*:*:**:******** ARP2_A MESAP---IVLDNGTGFVKVGYAKDNFPRFQFPSIVGRPILRAEEKTGNVQIKDVMVGDE ARP2_C MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE *:* :* ******** ***.***. **::*****:*: *.**::***:***** ARP2_D MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE ARP2_B MDSQGRKVIVVDNGTGFVKCGYAGTNFPAHIFPSMVGRPIVRSTQRVGNIEIKDLMVGEE ********:* *************:*** ****::*****:***.************:*

11 Novembre 2009Phylogénétique11 PhiloPhylo kit tout en 1, mais avec un choix limité de protéines au départ… banques de données de protéines (encyclopédie) contenant des informations biologiques et les séquences en acides aminés.www.uniprot.org

12 Novembre 2009Phylogénétique12 Le principe 1. Sélection: set de séquences de protéines homologues 2. Comparaison: alignement multiple 3. Construction de larbre: calculer les différences

13 Novembre 2009Phylogénétique13 Le principe Sélection: set de séquences de protéines homologues Comparaison: alignement multiple Construction de larbre: calculer les différences

14 Novembre 2009Phylogénétique14 PhiloPhylo

15 Novembre 2009Phylogénétique15 query par nom de protéines ou nom de gènes Utiliser Exemples: Blast Utiliser ou le

16 Novembre 2009Phylogénétique16 Scénario 5:

17 Novembre 2009Phylogénétique17 (query insulin)

18 Novembre 2009Phylogénétique18 Protein and gene nameS query FOLH1

19 Novembre 2009Phylogénétique19 Liste de protéines candidats

20 Novembre 2009Phylogénétique20 Le principe Sélection: set de séquences de protéines homologues Comparaison: alignement multiple Construction de larbre: calculer les différences

21 Novembre 2009Phylogénétique21 PhiloPhylo

22 Novembre 2009Phylogénétique22 Alignement multiple des séquences en acides aminés de linsuline de différentes espèces (query insulin, align)

23 Novembre 2009Phylogénétique23

24 Novembre 2009Phylogénétique24 Les mutations dans lADN peuvent être dûes à –Des erreurs lors de la réplication de lADN –Des agents chimiques ou physiques (fumée de cigarette, UV,…) –Des virus Les conséquences des mutations peuvent être des changements mineurs (changement dun acide aminé pour un autre) ou majeurs (duplication de gènes, délétion dun bout de chromosomes, …) Chez les mammifères, à chaque génération, il se produit en moyenne quelques dizaines de mutations dans le génome de chaque individu. –Si ces mutations se trouvent dans lADN des cellules sexuelles, elles seront transmises à la descendance. –La dérive génétique (genetic drift) et/ou la sélection naturelle (favorisant la sélection des individus avec des mutations qui augmentent les chances de reproduction et de survie dans un environnement donné) fixeront les mutations dans une population puis une espèce donnée.

25 Novembre 2009Phylogénétique25 (i) FR1 The FRIGIDA (FR1) gene has been shown to be a major determinant of flowering time in Arabidopsis thaliana. A majority of early-flowering ecotypes shows one or two deletions that generate a frameshift in the FR1 open reading frame (ORF), suggesting that this phenotype has arisen at least twice. Le Corre, Roux & Reboud (2002) performed a population analysis on different ecotypes and confirmed that the loss of function mutations was associated with an early- flowering phenotype, these gene inactivations systematically evolved in a non-neutral fashion. Moreover, they confirmed that the gene inactivation was phenotypically linked to an early flowering ecotype adaptated to cold environments (Johanson et al., 2000; Le Corre et al., 2002). This represents a strong indication that environmental change has driven this genetic change.Le Corre, Roux & Reboud (2002)Johanson et al., 2000; Le Corre et al., 2002 (ii) CCR5 This primate transmembrane receptor is a cellular gateway for the entry of HIV-1 and all strains of SIV. Human homozygotes for the CCR5 null allele which has a 32 base pair (bp) deletion are highly resistant to HIV-1 infection. Another null allele (24 bp deletion) of CCR5 has convergently evolved in sooty mangabeys (Cercocebus atys), a natural host of SIV. The occurrence of the mangabey null allele at an appreciable frequency (around 4%) could be explained by positive selection; null homozygotes are protected from SIV infection because the encoded protein is not transported to the cell surface (Palacios et al., 1998). The null allele has been shown to be positively selected in humans (Galvani & Novembre, 2005). However, the exact nature of the selective pressure involved in the origin of the CCR5-{delta} 32 allele and its high prevalence in European populations (approximately 10%) is unclear as the HIV epidemic in humans is much more recent than the age of the null allele (about 700 years). However, both HIV and poxviruses enter leukocytes using chemokine receptors; it is plausible that the loss of the CCR5 chemokine receptor originally conferred resistance against smallpox. This hypothesis is supported by a correlation between historical smallpox epidemics and allele geographic distribution (Galvani & Slatkin, 2003).Palacios et al., 1998Galvani & Novembre, 2005Galvani & Slatkin, 2003

26 Novembre 2009Phylogénétique26 Hélice alpha Peptide signal On ne peut pas muter nimporte quoi….

27 Novembre 2009Phylogénétique27 Propriétés physico-chimiques des différents acides aminés N Q D E R K F H W Y M I L V T S A G C P Hydrophilic NH2 OH Tiny Hydrophobic Aliphatic Aromatic Positive Negative Charged

28 Novembre 2009Phylogénétique28 (query insulin, align)

29 Novembre 2009Phylogénétique29 Les gènes (et les protéines) évoluent à des vitesses différentes Lhistone H4 na accumulé que 2 mutations conservatives en 1.5 milliard dannées

30 Novembre 2009Phylogénétique30 Une protéine qui a évolué extrêmement rapidement: linvolucrin (une protéine de la peau): 10 % de changements en lespace de 4 millions dannées (séparation des chimpanzés et de lhomme) Les gènes (et les protéines) évoluent à des vitesses différentes

31 Novembre 2009Phylogénétique31 Le principe Sélection: set de séquences de protéines homologues Comparaison: alignement multiple Construction de larbre: calculer les différences

32 Novembre 2009Phylogénétique32 Un arbre phylogénétique est un modèle qui décrit les relations entre des unités taxonomiques

33 Novembre 2009Phylogénétique33 Le résultat dépend de la protéine utilisée pour construire larbre….et le résultat ne correspond pas toujours à larbre des espèces…

34 Novembre 2009Phylogénétique34 Introduire le set de séquences sélectionnées à (format fasta) Utiliser les paramètres par défaut (one click)

35 Novembre 2009Phylogénétique35

36 Novembre 2009Phylogénétique36 Cladogramme obtenu à partir de lanalyse phylogénétique de lalignement multiple des séquences dinsuline Le résultat dépend de la protéine utilisée pour construire larbre….et le résultat ne correspond pas toujours à larbre des espèces…

37 Novembre 2009Phylogénétique37 Les différents types darbres (1)

38 Novembre 2009Phylogénétique38 Arbres (cladogrammes) B A Roots Internal nodes CDEFG B A CDEFG End nodes Branches

39 Novembre 2009Phylogénétique39 Peabody museum exhibition on the Tree of Life

40 Combien darbres différents ?

41 Novembre 2009Phylogénétique41 Les différents types darbres (2)

42 Arbres phylogénétiques Cladogramme Phylogramme La longueur des branches est proportionnelle aux différences. Cette longueur nest pas toujours facile à interpréter ! Elle dépend entre autre de la vitesse dévolution…(nombres de variations par site dans un laps de temps donné) Qui est le cousin de qui ?

43 Novembre 2009Phylogénétique43 Exemple de cladogramme obtenu à partir de lanalyse bioinformatique de lalignement multiple des séquences dinsuline - Qui est le cousin de qui ? Qui a un ancêtre commun ?

44 Exemple de phylogramme obtenu à partir de lanalyse bioinformatique de lalignement multiple des séquences dinsuline - Quelle protéine a évolué plus rapidement ? Le temps qui sécoule…. Echelle: expected number of changes per site

45 Novembre 2009Phylogénétique45 Exemple de phylogramme obtenu à partir de lanalyse bioinformatique de lalignement multiple des séquences dinsuline Probabilité que larbre ait la bonne configuration à chaque embranchement (> 0.95: OK) Le temps qui sécoule…. Linsuline de la carpe a évolué (moins de changements dans sa séquences en acides aminés) moins rapidement que linsuline des autres espèces…

46 Novembre 2009Phylogénétique46 Les embranchements Spéciation Duplication de gènes

47 Novembre 2009Phylogénétique47 Human gene A Mouse gene B Mouse gene A Human gene B Frog gene A Frog gene B Drosophila gene AB Orthologs Paralogs Homologs Gene duplication Ancestral gene Spéciation et duplication de gène speciation

48 Novembre 2009Phylogénétique48 Spéciation et duplication de gène Duplication ins1 – ins 2 Spéciation rat - souris

49 Novembre 2009Phylogénétique49 "Ce qui n'est pas entouré d'incertitudes ne peut pas être la vérité » R. Feynmann

50 Novembre 2009Phylogénétique50 A vous de jouer…

51 Novembre 2009Phylogénétique51 Ressources taxonomiques

52 Novembre 2009Phylogénétique52

53 Novembre 2009Phylogénétique53

54 Novembre 2009Phylogénétique54 Animal Diversity Web (ADW)

55 Novembre 2009Phylogénétique55 Perspectives et applications

56 Novembre 2009Phylogénétique56 Les mitochondries et chloroplastes sont dorigine bactérienne endosymbiotique Facteur délongation

57 Novembre 2009Phylogénétique57 Autres projets - ~200 protéines universelles - Arbre global Applications - métagénomes (identifications de nouvelles espèces, de nouveaux gènes (20 mo), de nouveaux enzymes….) -1ml deau de mer: 1 million de bactéries et 10 million de virus (C.Venter). - découvertes de nouvelles bactéries (la moitié de la biomasse) - médecine: identification de nouveaux pathogènes.

58 Novembre 2009Phylogénétique58 Références

59 Novembre 2009Phylogénétique59 Liste de gènes intéressants Conceptual bases for quantifying the role of the environment on gene evolution: the participation of positive selection and neutral evolution

60 Novembre 2009Phylogénétique60 (i) FR1 The FRIGIDA (FR1) gene has been shown to be a major determinant of flowering time in Arabidopsis thaliana. A majority of early-flowering ecotypes shows one or two deletions that generate a frameshift in the FR1 open reading frame (ORF), suggesting that this phenotype has arisen at least twice. Le Corre, Roux & Reboud (2002) performed a population analysis on different ecotypes and confirmed that the loss of function mutations was associated with an early- flowering phenotype, these gene inactivations systematically evolved in a non-neutral fashion. Moreover, they confirmed that the gene inactivation was phenotypically linked to an early flowering ecotype adaptated to cold environments (Johanson et al., 2000; Le Corre et al., 2002). This represents a strong indication that environmental change has driven this genetic change.Le Corre, Roux & Reboud (2002)Johanson et al., 2000; Le Corre et al., 2002 (ii) CCR5 This primate transmembrane receptor is a cellular gateway for the entry of HIV-1 and all strains of SIV. Human homozygotes for the CCR5 null allele which has a 32 base pair (bp) deletion are highly resistant to HIV-1 infection. Another null allele (24 bp deletion) of CCR5 has convergently evolved in sooty mangabeys (Cercocebus atys), a natural host of SIV. The occurrence of the mangabey null allele at an appreciable frequency (around 4%) could be explained by positive selection; null homozygotes are protected from SIV infection because the encoded protein is not transported to the cell surface (Palacios et al., 1998). The null allele has been shown to be positively selected in humans (Galvani & Novembre, 2005). However, the exact nature of the selective pressure involved in the origin of the CCR5-{delta} 32 allele and its high prevalence in European populations (approximately 10%) is unclear as the HIV epidemic in humans is much more recent than the age of the null allele (about 700 years). However, both HIV and poxviruses enter leukocytes using chemokine receptors; it is plausible that the loss of the CCR5 chemokine receptor originally conferred resistance against smallpox. This hypothesis is supported by a correlation between historical smallpox epidemics and allele geographic distribution (Galvani & Slatkin, 2003).Palacios et al., 1998Galvani & Novembre, 2005Galvani & Slatkin, 2003

61 Novembre 2009Phylogénétique61 Exemple de gènes / protéines

62 Novembre 2009Phylogénétique62 Divers - Simulation par ordinateur: avec 2 mécanismes, le hasard et la sélection, linformaticien Karl Sim a généré une complexité fascinante: reatures_1994

63 Novembre 2009Phylogénétique63 Phylogenetic servers

64 Novembre 2009Phylogénétique64 Un ancêtre commun

65 Novembre 2009Phylogénétique65 La construction darbre phylogénétique ne serait pas possible … sans la notion dancêtre commun… Les espèces ne sont pas immuables, mais issues dautres espèces et peuvent elles-mêmes donner naissance à de nouvelles. La sélection naturelle est opportuniste et ne poursuit aucun but à long terme. Jean-Baptiste de Lamarck et Charles Darwin

66 Novembre 2009Phylogénétique66 Cette notion dancêtre commun a été confirmée – par la découverte de lADN et du code génétique quasi universel* que se partagent tous les organismes vivants. *http://www.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi?mode=c – par la découverte de gènes très conservés entre les espèces (exemples: gène engrailed, histone H4, ARN ribosomal) et de gènes universels (~200).

67 Novembre 2009Phylogénétique67 Peabody museum exhibition on the Tree of Life

68 Novembre 2009Phylogénétique68 LUCA: Last Universal Common Ancestor LUCA est la racine de larbre de la vie, mais probablement pas le premier organisme unicellulaire vivant. Il devait être déjà complexe et donc le résultat dun long processus dévolution

69 Novembre 2009Phylogénétique69 Peabody museum exhibition on the Tree of Life

70 Novembre 2009Phylogénétique70

71 Novembre 2009Phylogénétique71


Télécharger ppt "Novembre 2009Phylogénétique1 Les nouvelles preuves de lévolution: y accéder en classe PO 422."

Présentations similaires


Annonces Google