La présentation est en train de télécharger. S'il vous plaît, attendez

La présentation est en train de télécharger. S'il vous plaît, attendez

Les enzymes : outils de biologie moléculaire Enzymes de restriction: endonucléases Kinases: ajoutent un phosphate (P*) Phosphatases: retirent un phosphate.

Présentations similaires


Présentation au sujet: "Les enzymes : outils de biologie moléculaire Enzymes de restriction: endonucléases Kinases: ajoutent un phosphate (P*) Phosphatases: retirent un phosphate."— Transcription de la présentation:

1

2

3 Les enzymes : outils de biologie moléculaire Enzymes de restriction: endonucléases Kinases: ajoutent un phosphate (P*) Phosphatases: retirent un phosphate Ligases: joignent un OH et un phosphate ADN Polymérase: ADN => ADN Reverse transcriptase : ARN => ADNc

4 Nomenclature des enzymes de restriction

5

6 Tailles des séquences incluses Tailles des séquences incluses –Plasmide bactérien ( 3-4 kb ) –Phage λ ( 9-22 kb ) –Cosmide ( 45 kb ) –PAC : P1-derived Artificial Chromosome ( kb ) –BAC : Bacterial Artificial Chromosome ( kb ) –YAC : Yeast Artificial Chromosome ( kb ) Vecteurs de clonage

7

8

9 NOMBRE DE CLONES A OBTENIR

10

11

12 PROJET PUBLIC: ETAPE 1

13 PROJET PUBLIC: ETAPE 2

14 PROJET PRIVE : CELERA

15 –Amplification dADN. –Base pour différentes techniques de biologie moléculaire : Séquençage Amplification de lADN pour le clonage mutation ponctuelle « differential display » préparation dADNc « RT-PCR » détermination de polymorphisme entre génomes (RFLP…) …. PCR : Polymerase Chain Reaction

16

17

18 Séquençage nucléotide : méthode de Sanger ddNTP : analogues structuraux des dNTP. ddNTP : incapables de réaliser une liaison phosphodiester. ADN polymérase incorpore dNTP ou ddNTP.

19 Séquençage nucléotide : méthode de Sanger

20 Séquençage : Méthode de Sanger Électrophorèse

21 Séquençage nucléotide : méthode de Sanger Liaison de lamorce avec lADN à séquencer. La fixation des ddNTP aux brins dADN va créer des brins de différentes tailles. Les brins vont migrer sur un gel délectrophorèse selon leur taille : le plus petit migre le plus vite.

22 Séquençage nucléotide : méthode de Sanger

23 Automatisation de la méthode : –Ajout sur les ddNTP de fluorochrome de différentes couleurs. –1 seul tube regroupant les ddNTP. –Lecture par un laser des fragments qui migrent sur le gel. –Stockage des données dans la mémoire de lordinateur.

24 Séquençage nucléotide : méthode de Sanger

25 Les ddNTPs fluos

26

27 Séquençage nucléotide : méthode de Sanger

28

29 Automatisation Séquençage sur capillaires :megabace Permet de séquencer 96 ou 386 échantillons en parallèle

30

31

32

33

34

35 RESTE A LIRE LA SEQUENCE ET COMPRENDRE TOUTES LES INFORMATIONS CONTENUES DANS LE GENOME ANNOTATION DU GENOME

36 Comment fonctionne le génome Quelle est lorganisation du génome? Comment est lue linformation contenue dans le génome? Mise en place du programme génétique

37 Paradoxe !!!!

38 Complexité du génome Humain Taille Mb pour gènes Nature répétitive –Séquences répétées localement ADN satellite –Séquences répétées dispersées SINES (Short Interspersed Repeated Sequences) –Ex: ALU, 300 pb tous les 6000 nucleotides LINES (Long Interspersed Repeated Sequenes) –Ex: L1, 5 kb, copies dans génome Rôle de lADN non génique ??? –Régulation globale de lexpression des gènes –Nucléosquelette

39 Complexité du génome humain Pourquoi les gènes sont dispersés? Pourquoi autant de répétitions? Pourquoi les gènes sont morcelés? Toutes les parties du génome sont elles utilisées dans toutes les cellules? Le génome évolue t-il avec la spécialisation des cellules?

40 Epissages alternatifs

41

42 Complexité du génome humain Pourquoi les gènes sont dispersés? Pourquoi autant de répétitions? Pourquoi les gènes sont morcelés? Toutes les parties du génome sont elles utilisées dans toutes les cellules? Le génome évolue t-il avec la spécialisation des cellules?

43

44

45 Initiation de la transcription Répresseur Activateurs FT Promoteur basal Facteurs dinitiation RNA Pol II Région codante Coactivateurs

46 Régulation du niveau dexpression des gènes

47 Interaction protéine -ADN

48 Interaction protéine – ADN

49 Quelques chiffres sur le génome Exons 1.1 % du génome Introns 70 % du génome Partie avec fonction inconnue 80% Gènes protéiques 5% Gènes dARN spécifiques ( ARNt,r ) <2% Gènes régulateurs ( réplicateurs, recombinateurs, ségrégateurs ) # 10%

50 Identifier les gènes spécifiques dun tissu ADN Tous les gènes possibles Tous les gènes nécessaires

51 EST Libraries construction Collection dESTs

52

53

54

55

56

57

58 Suivre lexpression des gènes

59 La Bioinformatique Les domaines explorés sont –Génomes –Transriptomes –Protéomes –Physiome

60 Les séquences Définition: suite de constituants unitaires des chaînes moléculaires représentées par un code lettre dans un chaîne de caractères. Ex: ADN suite de ATCG Ex : protéine suite des 20 AA Sont les objets manipulés le plus par les bioinformaticiens.

61 Exemple de séquence >mutant 1 MVSKLSQLQTEHLAALLESGLSKEALIQALGEPGPYLLAGEGPLDKGESCGGGRGELAEL PNGLGETRGSEDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVK SYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHA GQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAE CIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRHKLAMDTYSGPPPGPGPGPALP AHSSPGLPPPALSPSKVHGVRXGQPATSETAEVPSSSGGPLVTVSTPLHQVSPTGLEPSH SLLSTEAKLVSAAGGPLPPVSTLTALHSLEQTSPGLNQQPQNLIMASLPGVMTIGPGEPA SLGPTFTNTGASTLVIGLASTQAQSVPVINSMGSSLTTLQPVQFSQPLHPSYQQPLMPPV QSHVTQSPFMATMAQLQSPHALYSHKPEVAQYTHTGLLPQTMLITDTTNLSALASLTPTK QVFTSDTEASSESGLHTPASQATTLHVPSQDPAGIQHLQPAHRLSASPTVSSSSLVLYQS SDSSNGQSHLLPSNHSVIETFISTQMASSSQ Séquence de protéine au format fasta

62 Comparaison de séquences

63 Les outils dalignement

64 Exemple dalignement Score = 1213 bits (612), Expect = 0.0 Identities = 621/624 (99%) Strand = Plus / Plus Query: 374 aagcccttcagcggccagtagcatctgactttgagcctcagggtctgagtgaagccgctc 433 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 134 aagcccttcagcggccagtagcatctgactttgagcctcagggtctgagtgaagccgctc 193 Query: 434 gttggaactccaaggaaaaccttctcgctggacccagtgaaaatgaccccaaccttttcg 493 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 194 gttggaactccaaggaaaaccttctcgctggacccagtgaaaatgaccccaaccttttcg 253 Query: 494 ttgcactgtatgattttgtggccagtggagataacactctaagcataactaaaggtgaaa 553 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 254 ttgcactgtatgattttgtggccagtggagataacactctaagcataactaaaggtgaaa 313 Query: 554 agctccgggtcttaggctataatcacaatggggaatggtgtgaagcccaaaccaaaaatg 613 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 314 agctccgggtcttaggctataatcacaatggggaatggtgtgaagcccaaaccaaaaatg 373

65 Les médicaments


Télécharger ppt "Les enzymes : outils de biologie moléculaire Enzymes de restriction: endonucléases Kinases: ajoutent un phosphate (P*) Phosphatases: retirent un phosphate."

Présentations similaires


Annonces Google