La présentation est en train de télécharger. S'il vous plaît, attendez

La présentation est en train de télécharger. S'il vous plaît, attendez

Maladie dAlzheimer Cours du 6 novembre 2012 (4 séries de diapos) Série 3.

Présentations similaires


Présentation au sujet: "Maladie dAlzheimer Cours du 6 novembre 2012 (4 séries de diapos) Série 3."— Transcription de la présentation:

1 Maladie dAlzheimer Cours du 6 novembre 2012 (4 séries de diapos) Série 3

2 Maladie dAlzheimer (AD) Forme commune non héréditaire dans laquelle existent toutefois des facteurs de susceptibilité génétiques Formes très rares autosomiques dominantes Risque pour apparentés est très différent selon quil sagit dune forme autosomique dominante ou dune forme commune +++ Identification des gènes des formes rares : grand apport dans la compréhension des mécanismes physiopathologiques de cette affection

3 Maladie dAlzheimer: clinique Début après 60 ans le plus souvent. Présente chez % de la population après 80 ans cas dAD en France Troubles de la mémoire associés à une aphasie (troubles du langage), une apraxie (troubles des gestes), une agnosie (troubles de la reconnaissance des objets), des troubles du comportement Réduction progressive des capacités cognitives entrainant une perte dautonomie et une démence Examen neurologique souvent normal, surtout au début Altération des tests neuropsychologiques

4 Démence et perte dautonomie

5 Maladie dAlzheimer: a Maladie dAlzheimer: atrophie cérébrale +++

6 AD, examen microscopique du cerveau Perte neuronale essentiellement dans le cortex cérébral Présence de fibrilles dans dans les neurones Dépôts extra-cellulaires: plaques séniles contenant du peptide A (gène APP), de la protéine Tau et ApoE

7 Maladie dAlzheimer et génétique Faire systématiquement un arbre généalogique +++ Dans la grande majorité des cas: pas dautre sujet atteint Parfois un autre sujet peut être atteint. Le risque relatif davoir une maladie dAlzheimer est un peu plus élevé si on a un apparenté atteint < 1 % de formes héréditaires, autosomiques dominantes

8 Formes autosomiques dominantes dAlzheimer Très rares: < 1 % de formes héréditaires (autosomiques dominantes) Age de début plus précoce, voisin de 45 ans, parfois plus tôt Risque dun apparenté au premier degré dun patient AD atteint dune forme autosomique dominante est de 1/2 +++ Maladie hétérogène génétiquement: 3 gènes identifiés

9 Maladie dAlzheimer autosomique dominante Sain Malade * Allèle muté * Allèle normal * ******** ** ****** Le risque des apparentés au premier degré dun malade atteint dune forme dominante est de 1/2 +++ *

10 Formes autosomiques dominantes dAD: 3 gènes Ch 1 15 % Ch % PS2 PS1 Ch % APP Quelque soit le gène muté: accumulation du peptide amyloide dans le cerveau +++

11 Formes monogéniques rares dAD Diagnostic moléculaire chez un sujet malade Criblage des gènes PS1, PS2 et APP techniquement possible Mutations faux sens essentiellement Confirmation du diagnostic chez un sujet malade chez qui est suspecté une forme héréditaire autosomique dominante devant lhistoire familiale et lâge de début précoce

12 Formes monogéniques rares dAD Diagnostic moléculaire chez un sujet asymptomatique à risque PRUDENCE Sujet adulte, à risque, cliniquement indemne, souhaitant connaître son statut En labsence de thérapeutique, à ne pratiquer que chez des sujets dont les motivations ont été bien élaborées, dans le cadre dune consultation multidisciplinaire, au cours dune procédure se déroulant sur plusieurs mois. Aucun bénéfice chez un mineur Souhait denfant chez un sujet à risque / le problème du diagnostic chez un présymptomatique +++ / diagnostic prénatal / diagnostic préimplantatoire

13 Formes NON héréditaires dAlzheimer La maladie dAlzheimer est le plus souvent sporadique +++ Parfois aggrégation familiale (2 cas par exemple dans une famille) Notion de « terrain » et de possibles facteurs de susceptibilité génétique mais le risque conféré aux apparentés dun sujet nest que très modérément augmenté Un variant génétique clairement identifié: ApoE

14 La Maladie dAlzheimer est le plus souvent SPORADIQUE Exemple darbre généalogique Sain Malade

15 Maladie dAlzheimer NON mendélienne ApoE: un facteur de susceptibilité génétique Ch 19 ApoE Gène codant pour lapoliproproteine E 3 variants dans la population: E3 (78 % population normale) E4 (15% population normale) E2 (7% population normale) Dans une population de patients AD: % de sujets E4 Risque de développer la maladie multiplié par 3 chez sujets porteurs E4 MAIS E4 NI nécessaire NI suffisant pour développer un AD AUCUN APPORT DU CRIBLAGE MOLECULAIRE DE ApoE EN DIAGNOSTIC

16 Questions des patients et des familles Quelles sont les conséquences de la maladie sur mon conjoint ? Est ce quil y a un traitement Docteur ? Est ce que cest génétique Docteur ? Le cousin germain de mon mari a aussi un AD. Est ce que mes enfants vont aussi être atteints Docteur ? Docteur, est ce que mes enfants peuvent faire un test pour savoir sils sont porteurs du gène ? Est ce quil existe des associations qui pourraient maider ?

17 Apports de l identification des gènes impliqués dans les formes mendéliennes dAlzheimer pour la compréhension des mécanismes de la maladie dAlzheimer

18 Protéine APP KM DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVI ATVIVITL 142 Surface cellule TMDomaine extracellulaireIntracellulaire A Effet mutations: accumulation du peptide A 40 et A 42 dans le cerveau

19 PRÉSÉNILINE 1 (PS1) Protéine à 8 domaines transmembranaires, ancrée dans la membrane du réticulum endoplasmique et du Golgi Rôle dans la maturation de APP Mutations de PS1 (et de PS2) entrainent aussi une accumulation du peptide A


Télécharger ppt "Maladie dAlzheimer Cours du 6 novembre 2012 (4 séries de diapos) Série 3."

Présentations similaires


Annonces Google